KEGG   Thioalkalivibrio thiocyanoxidans: THITH_05390Help
Entry
THITH_05390       CDS       T03590                                 

Definition
(GenBank) bicarbonate ABC transporter permease
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
tti  Thioalkalivibrio thiocyanoxidans
Pathway
tti00910  Nitrogen metabolism
tti02010  ABC transporters
Module
tti_M00438  Nitrate/nitrite transport system
Brite
KEGG Orthology (KO) [BR:tti00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    THITH_05390
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    THITH_05390
Transporters [BR:tti02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    THITH_05390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: AHE97786
UniProt: W0DHA6
LinkDB All DBs
Position
1132051..1132980
Genome map
AA seq 309 aa AA seqDB search
MNAILDRNRAWFASPSVDRRPRAEASAAAPPESPAQPKLHRAVVGVIASRLRRIGTVLVP
PLVVAAVFLVLWEMATSSPGASLPSPSQVVSDTWDLIVQPFYDHGGNDVGLGWQLLASLE
RVAYGYLLAVIVGVALGVLVGQSTWAMRGLDPLFQILRTVPPLAWLPLSLAAFQDSNPSA
IFVIFITAIWPIIINTSVGIRNISQDYVNVARVLRLNGFEYFTRIMLPAAAPYVFSGLRI
GIGLAWLAIVAAEMLIGGVGIGFFIWDAWNSSMISDIVLALVYVGLVGFALDRIVAITGR
WVTRGTQVS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccattctcgatcgtaaccgggcctggttcgcctcgccctctgtggaccggagg
ccgcgggccgaagcatctgccgcggcaccgccggagagtccggcccagccgaaactgcac
cgtgcggtcgtcggcgtcatcgccagccgtttgcgccgaatcggaaccgtcctggtcccg
ccgctggtggtcgccgcggtgttcctggtgctctgggagatggccaccagcagccctggc
gcgtcgcttccctcgccatcgcaggtcgtatccgatacctgggatctgattgtgcagccc
ttttacgaccacggcggcaacgacgtcggcctcggctggcaactgcttgccagcctcgaa
cgggtcgcctacggctacctgctcgcggtgatcgttggcgtcgcgctcggcgtgctggtc
gggcagtcgacctgggcgatgcgggggctggacccgctgttccagatcctgcgcaccgtg
ccgccgctggcctggctgccgttgtcgctggcggcattccaggacagcaatccgtcggcc
atcttcgtgattttcatcaccgcgatctggccgatcatcatcaacacctcggtcggcatc
cgcaacatctcgcaggactacgtgaacgtggcccgggtgctgcgcctgaacggcttcgag
tacttcacgcggatcatgctgcccgcggcggctccctatgtgttttccgggctgcgcatc
ggcatcgggctcgcctggctcgcgatcgttgcggccgagatgctgatcggcggagtcggc
atcggcttcttcatctgggatgcctggaactcgtcgatgatcagcgacatcgtgctcgcc
ctcgtctacgtcgggctggtcggcttcgcactggaccgcatcgtcgccatcaccggccgc
tgggtcacccgcggcacacaggtcagctag

DBGET integrated database retrieval system