KEGG   Thermoproteus tenax: TTX_1107Help
Entry
TTX_1107          CDS       T01641                                 

Gene name
pepC-1
Definition
(GenBank) phosphoenolpyruvate carboxylase 1
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ttn  Thermoproteus tenax
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:ttn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    TTX_1107 (pepC-1)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    TTX_1107 (pepC-1)
   00680 Methane metabolism
    TTX_1107 (pepC-1)
Enzymes [BR:ttn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     TTX_1107 (pepC-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
958521..959894
Genome map
AA seq 457 aa AA seqDB search
MIPRLMCTQHPDTTVKITAGEEVDEALVAYTAYGCEEVMVDYEGKLTPFTQPKEIVMRAL
AAGVKLGEKFFITPRLPNPKLEEFDRAMLSLEAAVVANYFSLKYMDTQAVRWVVLPMVED
LDTVLLVRRMLRRKIQAYREETNLEISDIEVIPLIEDAFAQLKFEAFLAEIMRDGRVESF
RLFLGKSDSAVKYGHIASALAIVWVLSRVRRAEQELGIKIHPILGMGTPPFRGAINNPAL
AHLEVIQYAGYHTATIQSAIRYDASFEDYIKVKDSILNACCMDARGVDDVDKLVGEAATS
YKSVVAKYVNALLEVARLVPSTRDRVSWKVYGRQFVAEDRAVNMPRAIVYTSTWYAMGLP
PIFLDSPFIVKLAKEDRLDGLLKSLPTLKKEWEYDSEFFDYDTAAKYIGEELIKSVREAM
DYMGINPRTNGAYAALLRMPRSESNIIAMGKYRKFLG
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgattccgcggctcatgtgcactcaacatcctgacacgaccgtcaagataacggcgggc
gaggaggtagacgaggcccttgtggcctacactgcgtacggatgcgaggaggtcatggtc
gattatgagggcaagctgacgcccttcactcagcccaaggagatcgtcatgagggcgttg
gccgccggcgtgaagttgggcgagaagttcttcatcactcccaggcttccgaaccccaaa
ctggaggagttcgatagggcgatgctgtctcttgaggcggcggtagtggccaactacttc
tcgcttaagtatatggacacccaggcggtgaggtgggtcgtgttgcccatggtggaggac
ctagacacagttctcctggttaggagaatgttgaggaggaaaatacaagcatacagggag
gagacaaacctcgagatctccgacatagaggttataccgctgatcgaggacgccttcgcc
caactcaaatttgaggcgtttctcgccgagataatgagggacgggcgcgtggagagcttc
cgcctgttcttgggcaagtcagactcagctgtgaagtacggacacatagcctcggctctg
gcaatcgtctgggtgttgtccagagtgaggagggccgaacaggagctgggcatcaagata
catcccatcctcggcatgggcactccgcccttcagaggagctataaacaaccctgctctg
gcccacctggaggtgattcaatacgccggctaccacactgccactatccagtcggctata
cgttacgatgcgtccttcgaggactatatcaaggtgaaggactccatactgaacgcctgt
tgcatggacgcgagaggggtcgacgatgtggacaagctcgtgggcgaggcagccacgagc
tacaagtccgtagtagcgaaatatgtgaacgcgctcctcgaggtggcgaggctagtgccc
tccacgagggacagagtcagttggaaggtctacgggagacagttcgtggccgaggataga
gcagtcaatatgcccagagcaatagtctatacctccacttggtacgcgatgggcctcccg
cccatattcttggactcgccctttatagtgaagttggccaaggaggacaggctagacggc
ttgctcaagtcgctccctactctcaagaaggagtgggagtacgactcggagttcttcgac
tacgacactgccgccaaatacatcggagaggaattgataaaaagcgtcagagaggccatg
gactacatgggcataaacccgaggacgaacggagcctacgcggcgcttctgaggatgccc
cggagcgagtccaacataatcgccatgggcaaatacagaaagttcctgggttaa

DBGET integrated database retrieval system