KEGG   Thermobaculum terrenum: Tter_0308Help
Entry
Tter_0308         CDS       T01134                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
ttr  Thermobaculum terrenum
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ttr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tter_0308
  Energy metabolism
   00680 Methane metabolism
    Tter_0308
Enzymes [BR:ttr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Tter_0308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:329369..332164
Genome map
AA seq 931 aa AA seqDB search
MAIERAGTGDKLSEDVRLLGSIVGEVLIEQGGRRLFEIVEKLRTTSIALRTRYSEELHRE
LVQITSELDPATAFDVIRAFNLFFLVVNLAEENHRVRVLRQREISSYPEPLEGSIREAVR
DLRNEDISDEQLQELLNRLRARFVFTAHPTESRRRTTLMHLRHISNLIALLDDALLTPTQ
REMVIDRLREVVTALWQTDDFRETRPTPLDEVYNSLYFFQESVFEILPSVYREFSDALKS
VYKDWNFQIPPVIQFGTWMGGDRDGNPNVTPEVTIRTARLQKGVLLRHYISQLDRLRRHL
SMSVRRAGVSDELMQSIEKERKILPEASERIEERNKNEMYRLKIGLMIEKLKNTLSAMEA
RQRPQPDVAYESVEQFYTDIDMIVNSLKQNKGDRLALGAAEDFRRLAEVFGFHLAKIDVR
QHSSRHSQAIAEVLSSVGICDRYLELSSEEQAELLRELLRDNRPIIGKVHHFSPSTEETI
AVFDAIRTIQEEIGKEACDTYIISFAQSAADLLEIQLLARETGLLSISEGWSRLQIVPLF
ESIHDLNECGNIMANLLDDPIYRCNVKAWGDHQEVMIGYSDSNKDGGFFTSCWELYKAQR
RLAAVCSERGVTLRLFHGRGGAIGRGGGPTHMAILGQPPDTIHGELKLTEQGEVIFARYG
NPAIAKRYLEQVLNALLRVSLSPTVIENQSRIEPEWQEAADTLSTYSYREYRNLVYETPE
FVEYFREATPIGEISLLPIASRPVRRQSGFDIEQLRAIPWVFSWMQSRHTLPGWYGLGTA
IEKYIAGDDSKLKILQEMYQKWIFFRSTLDNAQMILSKADIHVASMYAGLVSNPDVWNRV
WPRIQQEYERTVYWVIKVTGLNRLLDNAPVLQRSIMLRNPYVDPISYIQVALLRKLRTIP
DTKDHKKERESILQAVFLSINGIAAGLQNTG
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggcgatagagagagctggcactggtgacaagcttagtgaggatgtacgcctccttgga
agcatagttggagaggtgctcatagaacaaggcggtcggcgattatttgaaatagtagaa
aagctcagaactacctctatagccttgcgtactaggtactcagaggaacttcatcgtgag
ttagttcaaataacctccgaacttgatcctgcgacagcctttgatgtaatacgagctttt
aacctcttctttctggtcgtgaatcttgctgaagaaaaccacagggtaagggtgctcagg
caaagggagattagtagttatcctgagcctctggaaggttcgattagagaggctgtaaga
gatctacgcaacgaggatatatcggatgagcagctgcaggagctattaaacagacttagg
gcaaggtttgtcttcactgcccatcctactgagtccaggcgaagaacgaccttgatgcac
cttagacatatatctaatctcatagccttgcttgatgatgctctcctgactcccacccaa
cgtgagatggttatagacaggctgcgggaagtagtaacagctctttggcagacagacgac
tttagagaaaccagacctactcctctggacgaggtctataacagcctctactttttccag
gagagtgtgttcgagattcttccctctgtctacagagagttctcagatgccttgaaatcg
gtatataaagactggaatttccagatacctcctgtcattcaatttggtacttggatggga
ggagatagggacggcaatcctaatgttacacctgaagtaactatacgtacagcgcgtctc
cagaaaggtgtattgctgaggcactatatatcccagctcgacaggcttcgcaggcatctc
tcgatgagtgttcgacgtgctggggtgagcgatgagctcatgcagtccatagagaaggag
agaaagatcctccccgaggcctctgaaaggatagaggagagaaacaagaacgagatgtat
cgcctgaagataggcctcatgatagaaaagctaaagaatactctctctgctatggaagct
agacagaggcctcagcccgatgttgcttatgagagtgtagagcagttctatacagatata
gatatgatcgtcaatagcctgaagcagaacaagggagacagactggctttaggcgcagca
gaggacttccggaggcttgctgaggtatttggatttcatcttgcaaagatagatgtgagg
cagcatagctctcgccacagccaggccatagcggaggtgttatcctcagtaggtatatgt
gacaggtacttggagctcagtagcgaggagcaagctgagctcctgcgtgagttgcttaga
gacaatcgacctatcataggtaaggttcaccacttttcaccttccaccgaagaaacaatc
gctgtctttgatgctatcagaaccatccaggaagagattggaaaagaagcttgtgacact
tacataataagctttgctcaatctgctgctgatctgcttgagattcagctgctggccaga
gaaactggtctactgtcgatatctgagggttggagcagacttcagatagtcccgttattt
gagagcatacatgacctaaacgagtgcggtaatataatggctaacctcctggatgaccct
atatatagatgcaacgtcaaggcatggggtgaccaccaggaagttatgataggttactcg
gactccaacaaggacggtggcttctttacgagctgttgggagctctacaaagctcagagg
cgtctggccgctgtgtgctctgagagaggcgttaccctaaggttgttccacggtagaggt
ggtgctataggtaggggaggagggccaacacatatggccatacttgggcaacctcccgat
accatacatggcgagctcaagctcaccgagcaaggtgaagttatatttgccaggtatggt
aatcctgcgatcgcgaagaggtatctggagcaggtgctgaacgctctactcagagtgagc
ctaagcccaaccgttatagaaaaccagagcagaatagaaccagagtggcaggaagccgca
gacactttgagcacctactcttatagagagtataggaatctagtgtatgagacgcctgag
ttcgtagaatacttccgcgaagctactcctataggcgagataagcctgctacccatagct
tcacgccccgtccgcaggcagagtggttttgatatcgagcagctcagggccatcccctgg
gttttctcctggatgcagagcaggcataccttaccagggtggtatggtcttgggactgct
atagagaagtatattgctggagacgattctaaactcaagatacttcaggagatgtatcag
aagtggatattcttcaggtctacattggacaacgctcagatgatactctctaaagctgat
atacacgtagcgagtatgtacgcgggattggtgagcaacccggatgtatggaatagggtt
tggcccaggatacagcaggaatatgaaagaactgtctactgggtaatcaaggtaactggg
ctcaacaggttgctcgataatgcgccagtgcttcagagatctatcatgctcaggaatcct
tatgtagatccaataagctacatacaggtagctctactacgcaagttgcgaacaattcct
gatactaaggatcataaaaaggaacgcgagagtatactgcaagcagtattcctctctatc
aacggcatagctgcaggtctacagaacactggataa

DBGET integrated database retrieval system