KEGG   Thermus thermophilus SG0.5JP17-16: Ththe16_0535Help
Entry
Ththe16_0535      CDS       T01867                                 

Definition
(GenBank) Malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
tts  Thermus thermophilus SG0.5JP17-16
Pathway
tts00020  Citrate cycle (TCA cycle)
tts00270  Cysteine and methionine metabolism
tts00620  Pyruvate metabolism
tts00630  Glyoxylate and dicarboxylate metabolism
tts00680  Methane metabolism
tts00710  Carbon fixation in photosynthetic organisms
tts01100  Metabolic pathways
tts01110  Biosynthesis of secondary metabolites
tts01120  Microbial metabolism in diverse environments
tts01130  Biosynthesis of antibiotics
tts01200  Carbon metabolism
Module
tts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tts_M00012  Glyoxylate cycle
tts_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:tts00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Ththe16_0535
   00620 Pyruvate metabolism
    Ththe16_0535
   00630 Glyoxylate and dicarboxylate metabolism
    Ththe16_0535
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Ththe16_0535
   00680 Methane metabolism
    Ththe16_0535
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Ththe16_0535
Enzymes [BR:tts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     Ththe16_0535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N DUF4885 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: AEG32961
UniProt: F6DEK6
LinkDB All DBs
Structure
PDB: 

Jmol
Position
complement(502015..502998)
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVAVTGAAGQIGYSLLFRIAAGEMLGKDQPVILQLLEIPQAMKALEGVVMELEDC
AFPLLAGLEATDDPKVAFKDADYALLVGAAPRKAGMERRDLLQVNGKIFTEQGRALAEVA
KKDVKVLVVGNPANTNALIAYKNAPGLNPRNFTAMTRLDHNRAKAQLAKKTGTGVDRIRR
MTVWGNHSSTMFPDLFHAEVDGRPALELVDMEWYEKVFIPTVAQRGAAIIQARGASSAAS
AANAAIEHIRDWALGTPEGDWVSMAVPSQGEYGIPEGIVYSFPVTAKDGAYRVVEGLEIN
EFARKRMEITAQELLDEMEQVKALGLI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggcacccgtacgcgtggcggttaccggagccgcgggacagatcggctacagcctc
ctcttccgcatcgccgcgggggagatgctgggcaaggaccagccggtgatcctccagctt
ttggagatcccccaggccatgaaggccctggagggcgtggtcatggagctggaggactgc
gccttccccctgcttgcgggcctcgaggccaccgacgaccccaaggtggccttcaaggac
gccgactacgccctcctggtgggggcggccccccgcaaggcggggatggagcgccgggac
cttttgcaggtgaacggcaagatcttcaccgagcagggccgggccctggccgaggtggcc
aagaaggacgtcaaggtgctggtggtgggcaaccccgccaacaccaacgccctcatcgcc
tacaagaacgcccccggcctcaacccccggaacttcaccgccatgacccggctggaccac
aaccgggccaaggcccagctcgccaagaagaccgggacgggcgtggaccgcatccgccgc
atgacggtgtggggcaaccactcctccaccatgttccccgacctcttccacgccgaggtg
gacggcaggcccgccctggagctcgtggacatggagtggtacgagaaggtcttcatcccc
accgtggcccagcggggggcggccatcatccaggcccggggggccagtagcgccgccagc
gccgcgaacgccgccatagagcacatccgcgactgggccctgggcaccccggagggggac
tgggtttccatggccgtcccctcccaaggggagtacggcatccccgagggcatcgtctac
tccttcccggtgacggccaaggacggggcgtaccgggtcgtggagggcctggagatcaac
gagttcgcccgcaagcgcatggagatcacggcccaggaactcctggacgagatggagcag
gtgaaggccctgggcctcatctga

DBGET integrated database retrieval system