KEGG   Thielavia terrestris: THITE_2142541Help
Entry
THITE_2142541     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
ttt  Thielavia terrestris
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    THITE_2142541
Enzymes [BR:ttt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     THITE_2142541
Transporters [BR:ttt02000]
 Other Transporters
  Pores ion channels [TC:1]
   THITE_2142541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(join(9647708..9648442,9648566..9648588,9648658..9648706))
Genome map
AA seq 268 aa AA seqDB search
MASTPNPPKPIVVWITPPGPNSWKVIVVLEELSLNYRIHSFRFDDVKKPPFIDINPNGRV
PAIEDPNTGITLWESGAILQYLIEVYDGAAHRLSYTGLAERHLCNQWLHFQMSGQGPYFG
QAGWFQHLHAEKIPSAIARYTAEIRRVLGVLDGVLAKKAKAEGKAEGSAVWLVGDKMTFV
DLAFLPWNFRLAEVLVQSWDEVWAGLPHVRAWHERMVELPSWKRSMEHRARLMDEQGLQW
NGVPKGIETFTEYEEKIARGEDTTALGK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcacaccgaacccgcccaagcccatcgtcgtgtggatcacccctccgggacca
aactcctggaaggtgatcgtggtcctggaagagctctcgctcaactacaggatccactcc
ttccgcttcgacgacgtcaagaagccgcccttcatcgacatcaacccgaacgggcgcgtg
ccggccatcgaggaccccaacacgggcatcacgctgtgggagtcgggcgcgatcctgcag
tacctgatcgaggtgtacgacggcgcggcgcaccggctgtcctacacgggcctcgccgag
cgccacctctgcaaccagtggctgcacttccagatgagcgggcagggcccctacttcggg
caggccggctggttccagcacctgcacgcggagaagatcccgtcggcgatcgcgcggtac
acggccgagatccggcgcgtgctgggcgtgctggacggcgtgctggccaagaaggccaag
gcggagggcaaagccgaaggcagcgcggtgtggctggtgggcgacaagatgacgtttgtc
gacctggcgttcctgccgtggaacttccggctcgccgaggtgctggtgcagagctgggac
gaggtctgggccggcctgccgcacgtccgcgcctggcacgagcgcatggtcgagctgccc
tcgtggaagcgctccatggagcaccgcgcccgcctcatggacgagcagggcctgcagtgg
aacggcgtgcccaagggcatcgagacgttcaccgagtacgaggagaagattgccaggggt
gaggataccactgcgttggggaagtga

DBGET integrated database retrieval system