KEGG   Teredinibacter turnerae: TERTU_0115Help
Entry
TERTU_0115        CDS       T00952                                 

Definition
(GenBank) trypsin
Organism
ttu  Teredinibacter turnerae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-ProteinID: ACR12819
UniProt: C5BKX1
LinkDB All DBs
Position
complement(128862..130145)
Genome map
AA seq 427 aa AA seqDB search
MKNITGIAFSFLMLIGICIPSHSNTLANESIAFDELERHKDEMNSMLYRVKKHELQVAMR
AIGELAESETEIRSAVRDLITPKIVGGGVAGTWENPFQVSLVVASISNNKNAHFCGGAFL
SSTQIVTAAHCVRGVSPSQIQVVANTRRLDGTGSRVGVSQISIHPKFNYRTLDYDIAVVR
LSSTVFNFPVDLAIEEPVAGSWLLVTGWGSLSEGGSSPTDLYALDIPVVSTASCNDANSY
SGDITSRMFCAGYESGGKDSCQGDSGGPITGGNSNSLLTGVVSWGFGCARPHYPGVYTKI
AHPEIRSFISSLAPAPVYPYNYTSYPYTVTGYGTQTNVYVRNAQGYTERLWGTRTYADLQ
ATANAYCRGLGYNRANYWRSEGCGEDEDSFIRFDPAINNWHSRNSGSANNRGGYCRYRLM
SEVSCAY
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaacataacaggtatagcatttagttttttaatgttgattggcatatgtattccg
tctcattcaaacacgcttgcaaatgaatctatcgcgttcgatgaacttgagcgtcataag
gacgaaatgaattccatgctttatcgcgtaaaaaagcatgaactacaggtagcaatgaga
gcgattggcgaacttgcagaatccgaaacagaaattcgctccgcggtacgtgatctgata
acgccaaaaattgtcggcggtggtgttgcaggcacatgggaaaatccgtttcaggtttca
ctcgttgttgcatcgatatcaaataacaagaatgcgcacttttgcggtggcgcgtttctt
tcgtccacacaaattgtgacggcagcgcactgtgtacgcggtgtctcgccaagccaaatt
caggttgtcgccaacacccgaaggcttgatggcaccgggtcccgggtgggtgtatctcaa
atttcgatacatcccaaatttaactatcgcactctggactacgatattgctgtcgtaaga
ttaagttcgacggtatttaattttccagtcgatcttgcgatagaagaacctgttgcgggc
agctggttgttggtaacgggctggggcagtctaagcgaaggtggctcgagccctacggat
ttgtacgctctcgatatcccagttgttagcaccgccagctgtaacgacgcgaactcgtat
tctggcgatattaccagtcgcatgttttgtgcgggttacgaaagtggtggcaaggattcc
tgccagggcgattctggcggccccatcactggaggaaattctaacagcctgcttaccggt
gtcgtgagctggggttttggctgcgcccgcccgcattaccctggcgtttacactaaaatc
gctcacccggaaattcgctcttttatcagttcgttggcacccgcgccagtctatccgtat
aactacaccagctacccctacaccgtcaccggttacggaacccaaaccaacgtttacgtt
cgcaatgctcaaggctacaccgaacgcctttggggtactcgcacctatgcggacctgcaa
gcaaccgcaaatgcctactgtcgcgggctaggctataaccgtgcaaattactggcggtcg
gaaggttgtggcgaagatgaagattcattcattcggtttgacccggcaatcaacaattgg
cactcccgaaattccggtagcgccaacaaccgcggcggttactgccgataccgccttatg
agcgaagtgagctgtgcttactag

DBGET integrated database retrieval system