KEGG   Teredinibacter turnerae: TERTU_0676Help
Entry
TERTU_0676        CDS       T00952                                 

Definition
(GenBank) glycoside hydrolase family 2 domain protein
  KO
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ttu  Teredinibacter turnerae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TERTU_0676
  Lipid metabolism
   00600 Sphingolipid metabolism
    TERTU_0676
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    TERTU_0676
Enzymes [BR:ttu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     TERTU_0676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
697127..699877
Genome map
AA seq 916 aa AA seqDB search
MRTKAAVVGLALAISAGMLSACIWTKPSNESASSPRERILLDDGWRFMKYEDAADADGLV
YDIRPDHSEHQDDKAADAKPTEAVTVHGGSNVLRPWILPMANPFIADPAQHYAAPASMPP
HGDFPFIQAEFDDRNWQTVSVPHDWAIQGPFYEGDKAPVGGGMGRLPSPGVGWYRKQIML
TEADAGKSLFLDIDGAMSYAMVWFNGHLVGGWPYGYASWRVDLTPYAEIGKPNQIAIRVD
NPPASSRWYPGGGLYRNVWLEKTQPVHVAQWGTNIVVSAADEQEATVRLSVALNNQSPAA
ASVQVETDVFELNEQDEPVGAAVAKVGPISTDVEGKGAATVDSRFRVINPKLWGPRPTQT
PNRYVAITKVVAQGKVVDEYRTPFGIRTIEIDPNLGVLVNGEPIYLQGVNQHHDLGALGA
AFNVRAAQRQLELLQEMGTNAIRLAHNPPARELLTLTDKMGFLVIDEVFDSWQRKKTPLD
FHLIFDDWSEADLRSMIRRDRNHPSVFMWSVGNEVGEQYTDTDGAKVGQRLHDIAHSEDP
TRPTAASMNYAKAHMPFPETMDTISLNYQGEGIRDAEAYAHLNGIRTPPSYPQFHKAFPG
KAIFSSENAAAVSSRGEYLFPVARGISAPVADGKGGDPTSAQVSAYELYTAPFGSSADKV
FRSLAQHPYVAGGFVWSGWDYLGEPTPYYSARSSYFGVIDLAGFKKDRFYLYQAHWRPDY
PMAHILPHWNWPDRVGKVTPVHVFTSGDEAELFVNGKSQGRKQKGDLEYRLRWDDVVYQP
GEVSVVAYKNGEEWATDSVVTTGEPAGLTLTVDRAGIQADGKDLAFVTATVVDANGRMVP
TAKPALTFTVSGAGELVATDNGDATDLVAFPSAKRSAFNGLALAIVRAKPGSTGTINVTV
AGENLSSAMIDLNSKK
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgagaacaaaagccgccgtagttgggctggctctcgccatatcagcaggcatgctcagc
gcgtgtatatggaccaagccctcaaacgagtcagcttcttcgccgcgggagcggattctg
ttggacgatggctggcgttttatgaagtatgaagacgccgctgacgccgatgggcttgtg
tacgacatccgcccggatcacagtgagcaccaggacgataaagccgccgatgcgaagccg
accgaggcggtaaccgtacacggcgggagcaatgtattacgcccctggattttgccgatg
gcgaacccgtttattgccgacccggctcagcattatgccgcccccgcaagcatgcctccc
cacggcgatttcccgtttattcaggcagagttcgacgatcgcaactggcagacagtctcc
gtccctcacgactgggcaattcaggggccgttttacgagggtgataaggcaccggttggc
ggtggcatgggccgactgccaagccccggtgttggctggtatcgcaagcagattatgttg
acggaagcggatgccggtaaatccctgtttttggatattgacggggccatgtcatacgca
atggtgtggttcaacggtcatttggtgggcggttggccctatggttacgcctcctggcgc
gtggacctcaccccttacgcggagataggtaaaccgaaccaaattgcaattcgggtggat
aatccgcccgcatcctcccgctggtaccccggcggcggtctctaccgcaatgtatggctg
gaaaaaacacagccggtgcacgtggcgcagtgggggacgaacattgttgttagtgcggcg
gatgaacaggaagcgacagtgcgcttgtctgtcgcgttgaataatcaatcgcctgccgct
gcatcggtgcaagtcgaaaccgatgttttcgaactgaacgagcaggacgagcctgtggga
gcggcggtcgcgaaagtggggccgattagcacagatgtcgaaggcaagggtgcggcaacg
gtagattctcgcttcagggtgataaatcccaaactgtgggggccgcggccaacccagaca
ccgaaccgctatgtggcgattaccaaagtagtcgcgcaaggcaaggtagtcgatgagtac
cgtaccccgttcgggatacgtactatcgagattgatccgaacctcggcgtgctcgtcaac
ggtgaacctatttatcttcagggggtgaaccaacaccacgacttgggcgcgctgggtgcc
gcatttaatgtgcgagcggcgcaacggcaattggagctgttgcaggaaatgggaaccaac
gcaatccgtctggctcacaacccacctgcccgcgagctgctcacgctcaccgataaaatg
ggttttctggtgattgatgaggtgtttgattcctggcagcgcaaaaagacgccgctggat
tttcatctgatcttcgacgactggtcagaagccgatttgcgctcgatgattcgccgcgac
cgcaatcatccctccgtatttatgtggagtgtaggcaacgaagtgggcgagcagtacacc
gacaccgacggagcaaaagtcggccagcgcttgcatgatattgcgcattcggaggacccg
acccggccgacggcggcgtcgatgaattacgccaaagcgcacatgcctttccccgaaact
atggataccattagcctgaattaccagggagagggcatacgcgatgcggaggcctacgcg
catttaaacggtattcgtacgccgccaagttacccgcagtttcacaaagcatttccgggc
aaggcgatttttagcagtgaaaacgcggccgcggtgagttcgcgcggagaatatttattt
ccggtggcgcgtggcatcagtgcgccggttgccgatggcaaaggcggagatccaacttct
gcccaggtcagtgcctatgaactctataccgcaccttttggctcatctgccgataaggta
tttcgctcgcttgcgcagcatccgtatgttgctggtgggtttgtgtggagcggttgggat
tatcttggcgaacccacaccctattattctgcgcgcagttcgtattttggcgtcatagat
ctcgccgggttcaaaaaagatcgcttctatctctatcaggcccactggcgccccgactac
cccatggctcatattctgccccattggaactggccagatcgggtgggcaaggtcacgcct
gtgcacgtttttacgtccggcgatgaagctgaattatttgtcaacggcaaatcccaaggg
cgcaagcaaaagggcgatctggagtatcgactgcgttgggacgatgttgtctatcagccg
ggagaggtgagcgtggtcgcttacaaaaacggtgaagaatgggcgacagactctgtggtg
acaacgggtgaacccgcaggcttaaccttgactgtggatcgcgccggcattcaagcggat
ggcaaagacctcgcttttgtcactgcaaccgtggtggatgcaaacggccgcatggttccc
accgcgaaacctgcgttgacgtttacggtaagtggggcaggcgagttggttgccactgac
aatggtgatgctacagatcttgtggcattcccatcggcgaaacgttccgcgtttaatgga
cttgctttggccatcgtgcgtgcaaaacctggtagcaccggtaccatcaacgtgactgtt
gctggcgagaacctttcttccgccatgatagatctgaacagcaagaaatag

DBGET integrated database retrieval system