KEGG   Teredinibacter turnerae: TERTU_1732Help
Entry
TERTU_1732        CDS       T00952                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00020  Citrate cycle (TCA cycle)
ttu00270  Cysteine and methionine metabolism
ttu00620  Pyruvate metabolism
ttu00630  Glyoxylate and dicarboxylate metabolism
ttu00680  Methane metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01130  Biosynthesis of antibiotics
ttu01200  Carbon metabolism
Module
ttu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ttu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ttu_M00012  Glyoxylate cycle
ttu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TERTU_1732
   00620 Pyruvate metabolism
    TERTU_1732
   00630 Glyoxylate and dicarboxylate metabolism
    TERTU_1732
  Energy metabolism
   00680 Methane metabolism
    TERTU_1732
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TERTU_1732
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TERTU_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C
Motif
Other DBs
NCBI-ProteinID: ACR13034
UniProt: C5BU70
LinkDB All DBs
Position
1802050..1803033
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVTVTGAAGQISYSLLFRIAAGEMLGADQPVILQMLEITPALEALKGVAMELDDC
AFPLLHSMVCTDDANVAFKDSDYALLVGARPRGPGMERNDLLEANAAIFSVQGKAINDHA
SRGIKVLVVGNPANTNALIAQRNAPDIDPRQFTAMTRLDHNRGMSQLASKLDVSINDITK
MTIWGNHSSTQYPDLYHALVKGDAAIDKVDSTWYAEEYIPTVQQRGAAIIKARGASSAAS
AANAAIFHMRDWALGSPEGDWVSMGVYSDGSYGIEKGLIYSFPCVCKNGDWEIVQGLSID
EFSQARMTATETELQGERDAVKALLPA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacccgtaagagttactgtgaccggcgcagcaggtcaaattagttattcgctc
ttgtttcgaattgccgctggcgaaatgcttggcgcggatcagcctgtaattttacaaatg
ctggaaatcactcctgcgctagaggctctgaaaggggttgcaatggagctggacgactgt
gcatttccgctgctgcatagcatggtgtgcactgatgacgcaaatgtcgctttcaaagat
tcagactatgcgttgctggttggtgctcgtccccgcggccctggtatggagcgcaacgat
ttgttggaagcgaatgccgcaatcttctctgttcaaggcaaggcgattaatgatcacgcg
tctcgtggcattaaagtcttggtggtgggtaacccggccaataccaacgcactgatcgcg
cagcgcaacgcgcctgacatcgacccgcgtcagtttactgcgatgactcgcctggatcac
aaccgcggcatgagtcaattggcgagcaaactggacgtatcaattaacgacattaccaaa
atgaccatctggggcaatcactcttctacccagtaccctgacctttaccacgcattggtt
aagggcgacgctgcaatcgataaagtcgacagcacttggtacgcggaagagtacatccca
acagtgcaacagcgtggcgcagccattattaaagctcgtggtgcatccagtgcagcctct
gcggcaaatgctgcgatcttccatatgcgcgattgggcattaggttctcctgagggagat
tgggtgagcatgggcgtgtatagcgatggtagctatggtatcgaaaaagggctgatttac
tctttcccctgtgtgtgtaagaacggtgattgggaaattgtacaaggcttgagcattgat
gaattctctcaagcgcgtatgaccgcaaccgaaactgagttgcaaggcgagcgggacgcc
gtaaaagcgttgttgccagcttag

DBGET integrated database retrieval system