KEGG   Teredinibacter turnerae: TERTU_1732Help
Entry
TERTU_1732        CDS       T00952                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  
malate dehydrogenase [EC:1.1.1.37]
Organism
ttu  Teredinibacter turnerae
Pathway
Citrate cycle (TCA cycle)
Cysteine and methionine metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Glyoxylate cycle
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TERTU_1732
   00620 Pyruvate metabolism
    TERTU_1732
   00630 Glyoxylate and dicarboxylate metabolism
    TERTU_1732
  Energy metabolism
   00680 Methane metabolism
    TERTU_1732
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    TERTU_1732
Enzymes [BR:ttu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     TERTU_1732
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1802050..1803033
Genome map
AA seq 327 aa AA seqDB search
MKAPVRVTVTGAAGQISYSLLFRIAAGEMLGADQPVILQMLEITPALEALKGVAMELDDC
AFPLLHSMVCTDDANVAFKDSDYALLVGARPRGPGMERNDLLEANAAIFSVQGKAINDHA
SRGIKVLVVGNPANTNALIAQRNAPDIDPRQFTAMTRLDHNRGMSQLASKLDVSINDITK
MTIWGNHSSTQYPDLYHALVKGDAAIDKVDSTWYAEEYIPTVQQRGAAIIKARGASSAAS
AANAAIFHMRDWALGSPEGDWVSMGVYSDGSYGIEKGLIYSFPCVCKNGDWEIVQGLSID
EFSQARMTATETELQGERDAVKALLPA
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacccgtaagagttactgtgaccggcgcagcaggtcaaattagttattcgctc
ttgtttcgaattgccgctggcgaaatgcttggcgcggatcagcctgtaattttacaaatg
ctggaaatcactcctgcgctagaggctctgaaaggggttgcaatggagctggacgactgt
gcatttccgctgctgcatagcatggtgtgcactgatgacgcaaatgtcgctttcaaagat
tcagactatgcgttgctggttggtgctcgtccccgcggccctggtatggagcgcaacgat
ttgttggaagcgaatgccgcaatcttctctgttcaaggcaaggcgattaatgatcacgcg
tctcgtggcattaaagtcttggtggtgggtaacccggccaataccaacgcactgatcgcg
cagcgcaacgcgcctgacatcgacccgcgtcagtttactgcgatgactcgcctggatcac
aaccgcggcatgagtcaattggcgagcaaactggacgtatcaattaacgacattaccaaa
atgaccatctggggcaatcactcttctacccagtaccctgacctttaccacgcattggtt
aagggcgacgctgcaatcgataaagtcgacagcacttggtacgcggaagagtacatccca
acagtgcaacagcgtggcgcagccattattaaagctcgtggtgcatccagtgcagcctct
gcggcaaatgctgcgatcttccatatgcgcgattgggcattaggttctcctgagggagat
tgggtgagcatgggcgtgtatagcgatggtagctatggtatcgaaaaagggctgatttac
tctttcccctgtgtgtgtaagaacggtgattgggaaattgtacaaggcttgagcattgat
gaattctctcaagcgcgtatgaccgcaaccgaaactgagttgcaaggcgagcgggacgcc
gtaaaagcgttgttgccagcttag

DBGET integrated database retrieval system