KEGG   Teredinibacter turnerae: TERTU_2784Help
Entry
TERTU_2784        CDS       T00952                                 

Gene name
pyk
Definition
(GenBank) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
ttu  Teredinibacter turnerae
Pathway
ttu00010  Glycolysis / Gluconeogenesis
ttu00230  Purine metabolism
ttu00620  Pyruvate metabolism
ttu01100  Metabolic pathways
ttu01110  Biosynthesis of secondary metabolites
ttu01120  Microbial metabolism in diverse environments
ttu01130  Biosynthesis of antibiotics
ttu01200  Carbon metabolism
ttu01230  Biosynthesis of amino acids
Module
ttu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ttu_M00002  Glycolysis, core module involving three-carbon compounds
ttu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
ttu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ttu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TERTU_2784 (pyk)
   00620 Pyruvate metabolism
    TERTU_2784 (pyk)
  Nucleotide metabolism
   00230 Purine metabolism
    TERTU_2784 (pyk)
Enzymes [BR:ttu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     TERTU_2784 (pyk)
Membrane trafficking [BR:ttu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    TERTU_2784 (pyk)
Exosome [BR:ttu04147]
 Exosomal proteins
  Proteins found in most exosomes
   TERTU_2784 (pyk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C UreE_N
Motif
Other DBs
NCBI-ProteinID: ACR11464
UniProt: C5BMN1
LinkDB All DBs
Position
complement(3067434..3068882)
Genome map
AA seq 482 aa AA seqDB search
MYRRTKIVATLGPATDEDGILEKLIIAGVNVVRMNFSHGSPEDHKQRAEMVREISARHNT
YVAILGDLQGPKIRVARFANGPIQLEIGDQFVLDAALDRDAGNQKEVGIDYKDLPRDVNP
GDMLLLDDGRVVLKVLSVDGTRISTEVVVGGKLSNNKGINRQGGGLSAPALTDKDREDIK
TAVEIGVDYLAVSFPRTADDMNLARQLARDAGGSMYMVAKIERAETVADHQVLDDVILAS
DAVMVARGDLGVEIGDAQLIGVQKHIIERARTLNRCVITATQMMETMISSPLPTRAEVFD
VANAVLDGTDAVMLSAETAAGKYPVQTVEAMVRVIRGAEKHPQAETSPAKPEGGYTAIDQ
AVAMSAMYAAHELQRVKCIASMTESGSTPLLMSRYGARLPIFAFSRNPKTLRRAALFRGV
QPILFDSDTIPHAETNVRAVEILREQENLEDGDMILISKGDYANVHGGTNTLKIVKVGQP
VS
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgtatagacgtacgaagattgtcgccacccttggcccggcaacggatgaagacggtatt
ctcgaaaagctgataatcgcgggtgtgaacgttgttcgtatgaacttttctcacggaagc
cccgaggatcacaaacagcgcgccgagatggttcgcgaaatctccgctcggcataacacc
tatgtcgcgattctcggtgatttgcaaggccctaaaatccgtgtagctcgttttgccaat
ggcccgatccagcttgagatcggcgaccagttcgtactcgatgcagcgcttgatcgcgat
gctggcaaccagaaagaagtgggtatcgactacaaagacctgccacgtgatgtgaaccca
ggcgacatgctgctgttggacgatggccgtgttgtgctgaaggtgctttctgtggacggc
actcgaatcagtactgaggttgttgttggcggtaagctgtccaacaacaaagggattaac
cgtcaggggggcggtttgtctgcaccagcgctgaccgacaaagaccgtgaagatattaaa
actgcggttgaaatcggtgttgactacctggcagtttcattcccgcgtacagcggatgac
atgaatctggcgcgtcagttggctcgtgacgctggcggctcaatgtacatggttgcgaaa
atcgagcgtgcagagactgtggccgatcaccaggttctcgacgatgttattctcgcatct
gacgcggtaatggttgctcgtggcgatctgggtgtggaaattggcgacgctcaattgatt
ggcgttcagaagcacatcatcgagcgtgcgcgcacgttgaaccgctgtgttattaccgca
acccagatgatggagacgatgatttccagcccactgccaacccgtgcagaggttttcgac
gtagccaacgcagtattggatggtactgatgcggttatgctgtctgcggaaactgctgcg
ggtaaataccctgtgcaaacggtagaggctatggttcgcgttatccgtggcgccgagaaa
catcctcaagctgagacttcacctgccaagcctgaaggtggctacaccgcaattgaccaa
gcggtggcgatgtccgccatgtatgcggcacacgagctgcaacgggtgaaatgtatcgct
tctatgaccgaatctggctccaccccgttgctgatgtcccgctacggcgcgcgtctgccg
atattcgccttctcccgcaaccccaagactctgcgtcgtgctgcgctgttccgcggtgtt
cagccgattctgtttgacagcgatactattcctcatgccgaaactaacgtgcgtgctgtt
gaaattctgcgtgagcaagagaacctggaagatggcgatatgattcttatctccaagggc
gactatgccaatgttcacggtggtaccaacaccctgaaaatcgtcaaggtcggtcagccg
gtttcttaa

DBGET integrated database retrieval system