KEGG   Tumebacillus sp. AR23208: CBW65_03480Help
Entry
CBW65_03480       CDS       T04874                                 

Definition
(GenBank) hypothetical protein
Organism
tum  Tumebacillus sp. AR23208
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
complement(713908..719124)
Genome map
AA seq 1738 aa AA seqDB search
MSTAYDWPTLVALLRFREETQGSRHAFSFFGEDGSEQQLTYAGLDRKARQLAVRLQRQTE
RGARVLLLFPPGLDYLISFFGALYAGAVPVPAYPPRQNGNLTRLLQVAADAQATAALTTE
TIWRGMSKRMEDAPALHGLQWITTEGLDAENGSDWREQTGSRDTLAFLQYTSGSTSAPKG
VMLTHGNLLHNLQMIETSFGTTPDSRGVVWLPPYHDMGLIGGILQPVFTGYPMTLMAPVD
FITKPLRWLQAITETGATVSGGPNFAYELCLQKIAPEEAEGLDLSRWEQAFTGAEPVRAE
TMRRFADVFASCGFRKEAFYPCYGLAEGTLLVTGGWKEAAPVEKRFDAGLLAQHQAVETA
DGAGVLVSSGRVTRTEQKVRIVDPLSLAPLADGKIGEIWVQGGSVALGYWNREEQTQETF
RAQVAGDADGYYLRTGDLGFILGGELFVTGRMKDLIIVSGRNHYPQDIEFTVQNCHPGVG
NSNGAAFAVEKDGQERLVVVQEVERTYRRGGHEEIVAAIRQAVSLQHGLPLEAVVLLKPA
SIPKTSSGKIQRHACKARYIDGTLDVLTESRTVSAVSAMAFAEQPQLTREEVLAAPADQR
SGALAGWMLSELAQVANISGTSLRADQPLAAAGLDSLMAVELKNRLEETWGVPVTLARLL
EGATAEELAEEIVQGMSEAGDVSAAGEIGNGMTYGQRSLWFLQQLDPASTAYHISKLVRV
RGPLDADRLADSLQQLQDRHELLRTVYPEVDGQPTAQLVEAARVDFAKVDRASDITDAAQ
QPFDLAQGPLFRARLFRQSKQEHLLLFSMHHIIADLWSLGMLIGELRELYSGGQAELESA
AVFADYVRWQNELLQSKRGEMLQTYWQEQLQGTPPVLNLPADRPRPPVQTYRGATLSLAV
PAMVAKGLKELAKQEGATLYMTLLAAFQALLHRSTGQEEIWVGTPTTGRSAAKFKDVFGY
FVNPVVMRAAVDGEESFRQLLRQVRTGVLGALSHADYPFPLLVEKLAPKRDLSAAPLFQV
MFSLQKSELQGGGDLSGFALNQDGAELVFGDVVLESVSMEQRAAQFDLTLSMVEGEDGLS
GTLEFNTDLFDPQTAQRLASCMESLLAGIASRPDCAVGGLPLLSMSGENAKITADDADAP
YPTQCLHQLFEQQAEERPDAEALELYGQTLTYRELNARANAVAHGLIARGVERGDAVGLS
LPRSSAWIVGMLGVLKAGGAYLPLDPVHPEERLQFMAQDAGAQIVLDEAGLRELTEAANA
ETHNPDLHVTPEQTAYLIYTSGTTGTPKGVACPHRGAVNLLAEMERRAPLAPNAAGSVWT
SFGFDVSVYEVFSALCYGRQLTVLPEEVRADGAACLDMLAEQKVASAYLPPFLLPDLAIF
VKNDPGRLQLTRLLVGVEPIRGELLQEIQRHLPGLVIVNGYGPTEASVCATLYTVSDKPE
RIVPIGTPLPNTEIWLLDQNGLPVPPGVIGELHIGGAGLAHGYIGRPELTAEKFVQLPLT
EVRLYKTGDLARLRSDGMLEYCGRLDDQVKVRGFRIELGEIEAVLAACASVRAAAVTVRD
DAPGGKRIIGYVVWEEDTDDAARDIGAIRRELKQKLPDYMVPSAFVTLDTLPQTVSGKLD
RRKLPAPQDDPAEQREYTAPRNEQEAQLCQLFAVLLGVEQVGVHDHFFERGGHSLLATQA
LTRVQTLFGVKLPLARLFEAPTPAELAVLIEQAKESAPVKQKPKTTRVAREARRQPRT
NT seq 5217 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgcatatgattggccaacactggtggcgctgttgcgctttcgcgaggaaact
caaggaagtcgacacgccttttctttttttggtgaagacgggtcggaacagcagctgacc
tatgctgggctggaccgcaaggcgcggcagctggccgtccgcctgcagcggcagacggag
cggggggcgcgcgtgcttttgctgttccctccagggctcgactacctgatctcctttttt
ggcgcgctgtatgccggagctgtgccggttcccgcgtatccgccgcggcaaaatggcaac
ttgacgcgcctgctccaagtggcggccgatgcacaggcgacggcggcgctgaccacggag
acgatctggcgcgggatgagcaagcggatggaagatgctccggcgcttcacgggctgcag
tggatcaccacggaggggcttgatgcggagaacggcagtgactggcgggagcagacgggc
agccgcgacacgctcgcctttttgcaatacacgtcgggatcgacgtccgcaccgaaaggc
gtgatgctgacccacgggaatctgctgcacaacctgcagatgatcgaaacgtcgtttggc
acgaccccggacagccgtggcgtggtctggctgcctccttatcacgacatgggcttgatc
ggcgggatcttgcagccggtgtttaccggctacccgatgacgctgatggcgccggttgat
tttattacgaagccgctgcgctggctgcaagcgatcacagagacgggcgcgacggtgagc
ggcgggccgaattttgcgtatgagctgtgcttgcagaaaatcgcgccggaggaggctgaa
gggctggatctgtcgcgctgggagcaggcgtttaccggcgctgaaccggtcagagcggag
acgatgcgcagatttgcagatgtttttgcttcgtgcgggtttcgcaaagaggcgttttac
ccgtgttacgggttggcggaaggcacgctgttggtcaccgggggctggaaagaagcagcg
ccggtggaaaagcgcttcgatgccgggctgttggcgcagcatcaggctgtggaaacggca
gacggcgcaggggtgctggtgtcttccggacgcgtgacgcgcacggagcagaaagtgcgg
atcgtcgatccgctgtcgctggcaccgcttgcggacggcaaaatcggcgagatctgggtg
cagggcggcagtgtggcgctcggctactggaaccgcgaagagcagacgcaagagacgttt
cgggcgcaggtggcaggcgacgcggacggatactatctgcggacgggcgaccttggattt
atcctcggcggggagctgtttgtgaccgggcggatgaaagatctgatcatcgtcagcggc
cgcaatcactacccgcaggacatcgagtttacggtgcaaaactgccaccccggcgtcggc
aactcgaacggggcggcatttgctgtggaaaaagacgggcaggagcgtctggtcgtcgtg
caggaagtggagcgcacctaccgcagagggggccatgaggagatcgtcgcggcgatccgc
caggcggtgtcgctgcagcatgggctgccattggaagcggtcgtgctgctcaagccggcg
agcatccccaagacctcgtcgggcaagattcagcgccatgcctgcaaagcgcggtacata
gacgggacgctggacgtcttgaccgagagccggacggtgtcggcggtgtcggccatggca
tttgcggagcagccgcagctgacgcgggaagaagtgctggcagcgcctgccgatcagcgg
tccggggcattggcaggctggatgttgtcagaattggcacaagtcgcgaacatttcggga
acaagccttcgggcagatcagccgctggcggcggccgggctcgactcgctgatggcggtg
gagctgaaaaaccgtctcgaagaaacctggggtgtgccggtcacgttggcccgcttgctg
gaaggcgcgacggcggaagagctggctgaggagatcgtgcaggggatgagcgaagcgggc
gacgtgtcggcagccggggagatcgggaacggcatgacgtacggtcagcgttccttgtgg
ttcctgcagcagctggacccggcgagcaccgcgtaccacatctccaaactggtgcgggtg
cgtggcccgctcgatgcggatcgtctggcagacagcctgcagcagctacaggaccgccac
gaactgctgcggacggtgtacccggaagtggacggccagccgaccgcacagctcgtcgag
gcggccagggtcgattttgcaaaagtggaccgggcatctgacatcaccgatgcggcgcag
cagccgttcgatcttgcccaagggccgctgttccgggcgcgcttgttccggcagtcgaag
caggagcatctgctgctgttcagcatgcaccacatcatcgccgacctgtggtcgctcggc
atgctgatcggcgaactgcgcgaactgtacagcggcggccaggcagagctggagagcgca
gccgtttttgccgactatgtgcgctggcaaaacgagttgctgcaaagcaagcgcggcgag
atgctccagacgtattggcaggagcaactgcaaggcacaccgccggtgctgaatctgccg
gccgaccgtccgcgcccgccggtgcagacttatcggggggcaacgctttcgcttgcggtg
cccgctatggtcgccaaggggctgaaggagctggccaagcaggaaggcgcgacattgtac
atgacgctgctcgctgcttttcaggcgctgttgcaccgctccaccgggcaagaggagatc
tgggtcggcacgccgacgacaggtcgcagcgcggcgaaatttaaagatgtgtttggctac
ttcgtcaacccggtcgtgatgcgtgctgcggtagacggagaggaatcgttcaggcagttg
ctgcgccaagtgcggaccggtgtgctcggcgctctgtcccatgccgattatccgttcccg
ctgctggtggaaaagctggccccgaagcgcgacttgagcgctgcccccctgttccaagtg
atgttctccttgcagaaatcggagctgcaaggcggcggggacctgagcggatttgctctg
aatcaggacggcgcggagctggtgtttggcgatgtcgtgctggagtcggtcagcatggag
cagcgtgcggcgcagttcgatctgaccttgtcgatggtcgaaggagaggacgggctgtcc
gggacgctggagtttaacaccgacctgtttgatccacagacggcacagcggctggccagc
tgtatggaaagcttgctggcaggcatcgcatcgcggccggactgtgcggtcggcggattg
cctctgctctcgatgagcggcgaaaacgccaagatcacagcggacgacgcggatgccccg
tacccgacgcaatgtctgcatcagctgtttgaacagcaggcggaggagcgccccgatgcg
gaggcgcttgaactgtacggtcagacgctgacctaccgcgagctgaatgcgcgagccaac
gccgtcgcccacgggttgatcgcacgcggtgtggagcggggcgatgctgtcgggctgtcc
ctgccccgttcttctgcgtggatcgtcgggatgctcggcgtgctcaaagcgggcggcgcg
tatctgccgctcgacccggtgcatccggaggagcgtctgcagtttatggcgcaagacgcc
ggtgcgcagattgtgctcgatgaagccgggctgcgcgaactgaccgaagcggcaaatgcc
gagacgcacaatcccgatctgcacgtaacgcctgagcagaccgcctacctgatctacaca
tcgggcaccaccggcacgcccaaaggggtggcctgcccgcatcgcggcgcggtcaacctg
ctggcggagatggagcggcgggcaccgctggcacccaatgcggcgggcagtgtctggacc
tcttttggcttcgatgtgtcggtctatgaagtgttcagtgcgctgtgctacggacgccag
ctgacggtgctgccggaagaggtgcgtgccgacggcgcggcttgtctggacatgctcgcc
gagcaaaaggtggccagcgcgtatctgccgccatttttgctgcccgatctcgcaatcttc
gtcaaaaacgatccgggtcgcctgcagctgacccgcctgctggtcggcgtggaaccgatt
cgcggagagctgctgcaggagatccaacgccatctgccgggccttgtcatcgtcaacggc
tacggcccgaccgaagcgagcgtctgcgccaccttgtacaccgtgtcggacaaaccggag
cggatcgtgccgatcggaacgccgctgccaaacacggaaatctggctgctcgaccaaaac
ggtctccctgtgccgccgggagtgatcggcgaactgcatatcggcggcgcgggactggcc
cacggctacatcggacggccggagctgaccgcagaaaaatttgtccagctgcctctgacc
gaagtgcgcctgtacaagacgggcgacctggcccgcctgcgcagcgacgggatgctggaa
tactgcggtcgcctcgacgaccaggtcaaagtgcgcggtttccgcatcgagctcggcgag
atcgaagcggtgctggccgcctgtgcctcggttcgcgcggctgcggtcaccgtgcgcgac
gacgcgccgggcggcaagcggatcatcggctatgtcgtctgggaagaagacacggatgac
gctgcccgagatatcggcgcaatacgccgcgaattgaagcaaaagctgcccgactacatg
gtgccgtccgcgtttgtcacgctcgacaccctgccccagacggtcagcggcaagctcgac
cgccggaaactgcctgcgccgcaggacgacccggctgaacaacgcgagtacaccgcgccg
cgcaatgagcaggaagcacagttgtgccagctgtttgcagtgcttttgggcgtggagcag
gtcggcgtgcacgatcacttttttgaacggggcggccattcgctgctcgccacgcaggct
ttgacccgcgtgcagactctgtttggcgtcaagttgccgctggcccgcctgtttgaagcg
ccaacgcccgcagagctggccgtgctgatcgaacaggcgaaagagtcagctccggtcaaa
caaaagccgaaaaccacgcgcgtcgcccgcgaagcccgccggcagccgcgcacctag

DBGET integrated database retrieval system