KEGG   Tupaia chinensis (Chinese tree shrew): 102469443Help
Entry
102469443         CDS       T02978                                 

Gene name
ASH1L
Definition
(RefSeq) ASH1 like histone lysine methyltransferase
  KO
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tup00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102469443 (ASH1L)
Enzymes [BR:tup01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102469443 (ASH1L)
Chromosome [BR:tup03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102469443 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 2969 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSVINTGTLVSKREVELENHTKEEEDLRKRNRERSIEA
EKDDDLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKAGDVAAIECQSEEIIHLHSQAENISLSKKLSP
VHSEMADYINATPSSLVSSRDPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTTAGLVSKDLIRKASVGSVAGIIHKDLIKKPAISTAVGLVTKDPGKKPVFNAAVGLV
NKDSVKKLGTGTTAVFINKDLGKKPGTITTVGLLSKDSGKKLGIGIVPGLVNKDSGKKLG
LGTVVGLVNKDLGKKLGSTVGLVAKDCAKKIVASSAMGLVSKDIGKKLMSCPMAGLVSKD
AINLKAEALLPTQEPLKASCSTNISNHESQELSESPKDSATTKTFEKNVIRQSKESILEK
FSVRKEIINLEKEMFNEGTCIQQDNFSSSERGSYETSKHDKQPPVYCTSPDFQMGGASDA
STAKSPFSAVGESNLPSPSPTVSVNPLTRSSPETSSQLAPNPLLLSPSTELMEEISESVG
KNQFNSDNTHLNVGHRSMGHNISIECKGIDKELNDSKTAHIDIPRISSSLGKKPSLTSES
SIHTITPSVVNFTSLFSNKPFLKLGAVTASDKHCQVAESLSTGLQSKPLKKRKGRKPRWT
KVVARSTCRSPKGLELERSELFKNVSCSSLSNSNSEPAKFMKNIGPSSYVDHDFLKRRLP
KLSKSTAPSFALLTDSEKPSHKSFATHKLSSSMCVPSDLLSDIYKPKRGRPKSKEMPQLE
GPPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSP
VKMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDSHRPSVCSMS
DLEMEPDKKITKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHN
TVSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILTGSPTSLAVLEQTAQQA
AGSALGQILPPLLPSSASSSEILPSPICSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHS
RQGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSD
SGIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLNSLKEKHKHKCKRRNHDYL
SYDKMKRQKRKRKKKYPQLRNRQDPDFIAELEELISRLSEIRITHRSHHFIPRDLLPTIF
RINFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSGTGFYP
SYGMPYSPSPITAAPIGLGYYGRYPPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYH
KKKHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQV
SMDTGSSRSVLESLKRYRFGKDTVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHRE
PSESSSLALGLQTPLQIDCSESSPSLSLGGFTPNSEPASSDEHTNLFTSAIGSCRVSNPN
SSGRKKLTDSPGLFSAQDTSLNPLNRPHRKEPLPSSERAVQTLTGSQQTSDKPSQRPPSE
STNCSPSRKRSSSESTSSTVNGVPSRSPRLVTSGDDSVDSLLQRMVQQEDQDPMEKNIDA
VITTASVPPSSSPACSHSKERTLGKPDSLLVPAVPSDSCSNSISLLSEKLARSCSPHHIK
RSVVEAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKC
PLQAVVSMQAFQAAQFVRPELNEDEEESALHLGPDTVTDVIEAVVQSVNLNPEHKKGLKR
KNWLLEEQTRKKQKPLPEEEEEEENNKSFTEAPVEIPSPPETPAKPPEPESTLQPVLSLI
PREKKAPRPPKKKYQKAGLYSDVYKTTDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVG
KYLRQKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKK
PDDNTGKGCMDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIR
TKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARF
INHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKC
RGIIGGKSQRMNGLTSSKTSQPMTTHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINTP
TRLAPQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKHTSDNIHSASLYSRWNGI
CRDDGNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIIAYK
DSSRQALAAPLLNLPPKKKNADYYEKISDPLDLITIEKQILIGYYKTVEAFDADMLKVFL
NAEKYYGRKSPIGRDVCRLRKAYYNARHEASAQIDEIVGETASEADSSETSVSEKENGHE
KDDDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMI
PRPHYAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLD
IFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCC
VLDLYTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTP
KRDFSPHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLASQEQAANEMPS
LEEPEREGATAEVSEVEKKTEDCSQESQSACTPAERRHNQRERLNQILLNLLEKIPGKNA
IDVTYLLEEGSGRKLRRRTLFIPENCFRK
NT seq 8910 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgattccgaaggtttttcaaga
aagagtccttctgtcatcaatactggtacactggtcagcaagagagaagtagagttagag
aaccacacaaaggaagaagaggaccttcgcaaacggaatcgggaaagaagcattgaagca
gagaaagatgatgatttgactgatgcacagcaacagttttcagtgaaagaaacaaacttt
tcagagggaaatttaaaattaaaaattggccttcaggctaagagaactaaaaaacctcca
aagaacttggagaactatgtatgtcgacctgccataaaaacaactatcaagcacccaagg
aaagcacttaaaagtgggaagatgacagatgaaaagaatgaacactgtccttcaaaacgg
gacccttcaaagttgtacaagaaagcaggtgatgttgcagccattgaatgccagtctgaa
gaaatcatccatcttcattcgcaggcagaaaacatttctttatctaagaaactttctcca
gtacactcagaaatggcagattatattaatgcaacaccctcttctctggtcagtagccgg
gatcctgatttaaaggacagagcattacttaatggaggaactagtgtaacagaaaagttg
gcacaactcattgctacttgtcctccttccaagtcttccaagacaaaaccgaagaagtta
ggaactggcactacagcaggattggttagcaaagatttgatcaggaaagccagtgttggc
tctgtagctggaataatacataaggacttaataaaaaaaccagctatcagcacagcagtt
ggattggtaactaaagatcctggaaaaaagccagtatttaatgcagcagtaggattggtc
aataaggactctgtgaaaaaactgggaactggcactacagcggtattcattaataaagac
ctaggcaaaaagccagggactatcactacagtagggctgctgagcaaggattcaggaaag
aagctaggaattggcattgttccaggtttagtgaataaggactctggcaagaagttagga
cttggcactgtggttggattggttaataaagatttgggaaagaaattgggttctactgtt
ggcctagtggctaaggactgtgctaaaaaaattgtagcaagttcagcaatgggattggtt
agtaaggatattggaaagaagctaatgagctgtcctatggcaggactagtcagtaaagat
gccataaaccttaaagctgaagcactgctccccactcaggaaccacttaaagcttcttgt
agtacaaacatcagtaatcatgaaagtcaggaactttctgaatccccgaaagacagtgcc
accaccaaaacttttgagaagaatgttatacggcagagtaaagaaagcattttggaaaag
ttctcagttcgaaaagaaataatcaatttagagaaagaaatgtttaatgaaggaacatgc
attcaacaagacaatttctcatccagtgaaaggggatcttatgaaacctcaaagcatgac
aagcaacctcctgtatattgcacttctccagactttcaaatgggaggtgcttctgatgca
tctacagctaagtccccttttagtgcagtaggagaaagcaatctcccttccccatcacct
actgtatctgttaatcctttaaccagaagttcccctgaaacttcatcacagttggctcct
aatccattacttttaagtccttccacagaactaatggaagaaatttctgaatctgttgga
aagaaccaatttaattctgacaatacccacttgaatgttggtcataggtcgatgggtcat
aacataagtattgaatgtaaagggattgataaagagctaaatgattcaaaaactgcacat
atagatattccacgaataagctcttctctgggaaaaaagccaagtttgacttctgaatcc
agtattcatacaattactccttcagttgttaacttcaccagtttatttagtaacaagcct
tttctaaaacttggtgcagtaactgcatcagacaaacactgccaagttgctgaaagcctg
agcactggtttgcagtccaaacccttaaaaaaaagaaaaggaagaaaaccacggtggact
aaagttgtggcaagaagcacatgccggtctccaaaagggctagaattagaaagatcagag
ctttttaaaaacgtttcttgtagttcattatcaaatagtaattctgagccagccaagttt
atgaaaaacattggaccatcttcatatgtagatcatgacttccttaaacgtcgattgcca
aagttgagcaaatccacagctccatcttttgctctcttaactgatagtgaaaaaccatct
cataagtcttttgctactcataaactatcttccagtatgtgtgtccctagtgaccttttg
tctgatatttataagcctaaaaggggaagacctaaatctaaggagatgcctcagttggaa
ggtcctcctaaaaggactttaaaaatccctgcctctaaagttttttctttacagtctaag
gaagaacaagaacccccaattttacagccagaaattgaaattccatccttcaaacaaagt
ctgtctgtgtctccttttccaaaaaagagaggcaggcctaagaggcaaatgaggtcacca
gtcaagatgaagccacctgtgctatcagtggctccatttgttgccactgaaagcccgagc
aagctagagtctgaaagtgacaaccatagaagtagcagtgatttctttgagagcgaggat
caacttcaggatccagatgatctagatgacagtcatagaccaagtgtctgtagtatgagt
gaccttgaaatggaaccagataaaaaaattaccaagagaaacaatggacaattaatgaaa
actattattcgcaaaataaataagatgaagactttaaagagaaagaaactgttgaatcag
attctttcaagctctgtagaatcaagtaataaagggaaagtgcaatccaaactccataat
acagtgtcaagtcttgctgccacatttggttctaaattgggccaacagataaatgtcagc
aagaaaggaactatttacataggaaagagaaggggtcgcaaaccaaaaactgtcttaaat
ggcattctgactggtagtcccaccagccttgctgttcttgagcagacagctcagcaagca
gctgggtcagcattaggacagattcttccccctttactgccttcatctgctagtagttct
gagattcttccatcacctatttgttctcaatcttctgggactagtggaggtcagagccca
gtaagtagtgatgcaggcttcgttgaacccagttcagtgccatatttacatttacactcc
aggcagggcagtatgattcagactctagcaatgaagaaggcctcaaagggaaggagacgg
ttatctcctcctactttgttgccaaattctccttcgcacttgagtgaactcacatctctg
aaagaagctactccttccccaattagcgagtctcatagtgatgagaccattcctagtgat
agtggaattggaacggataataacagcacatcagatagggcagagaaattttgtgggcaa
aaaaagaggagacattcctttgagcatgtttctctgattccccctgaaacgtctaccgtc
ctgaacagtcttaaagaaaaacataaacacaaatgtaagcgcaggaatcatgattacctc
agctatgacaagatgaaaaggcagaaacgaaaacggaaaaagaaatatccccaactccga
aacagacaggatccagactttattgcagagctggaggaactaataagtcgtctaagtgaa
attcggatcacccatcgaagtcatcattttataccccgagaccttctgccgactattttt
cgaatcaactttaatagtttctatacacatccttctttccccttagaccctttgcactac
attcgaaaacctgacttaaaaaagaaaagagggagacctcctaagatgagggaggccatg
gctgaaatgccttttatgcacagccttagttttcctctttctggtactggattctatccc
tcatatggcatgccttattctccttcacccattacagctgctcccataggattaggttac
tatggaaggtatccacccactctttatccaccacctccatctccttctttcaccactcca
cttccacctccttcctatatgcatgctggtcatttacttctcaatcccaccaaataccat
aagaaaaagcataagctacttcgacaggaggcctttctaacaaccagcaggacgccactt
ctttctatgagtacctaccccagtgtccctccggagatggcctatggttggatggttgag
cacaagcacaggcaccgtcacaaacatagagaacatcgttcttctgaacaaccccaggtt
tccatggacactggctcttccagatctgtcctggagtctttgaaacgctatcgatttgga
aaggatactgttggagaacggtataaacataaggaaaagcaccggtgtcacatgtcctgc
cctcatctctctccttcaaaaagcttaataaacagagaagaacagtgggtccaccgagag
ccttcagaatctagttcattggccttgggattgcagacacctttacagatcgactgttca
gaaagttctccgagtttatcccttggaggattcactcccaactctgagccagccagcagt
gatgaacatacgaaccttttcacaagtgcaataggcagctgcagagtttcaaaccctaac
tccagtggccggaagaaattaactgacagccctggactcttttctgcacaggacacttca
ctaaatccactaaatcggcctcacagaaaggagccactgccttccagtgaaagggcagta
cagaccttgacaggttcccagcaaacctcagataaaccctcccagcgaccaccatcagag
agcacaaactgtagcccttcccggaagaggtcttcgtctgaaagtacttcttcaacagtg
aacggagttccatctcgaagtccaagattggttacgtctggagatgactctgtggatagt
ctgctacagcggatggtacaacaagaggaccaagatcctatggagaaaaatattgatgct
gtaattacaactgcgtctgtacccccttcctctagtccagcttgtagccacagcaaggaa
cgaaccctgggaaaaccagacagccttctagtgcctgcagtcccaagtgactcttgcagt
aatagcatctcactcctttctgaaaagttggcaaggagctgttccccccatcacatcaag
agaagtgtagtggaagccatgcagcgccaagctcggaaaatgtgcaattatgacaaaatc
ttggccaccaagaaaaacctggaccatgtcaataaaattttaaaagccaaaaaacttcaa
aggcaggccaggacaggaaataactttgtgaaacgcagaccaggtcgacctcgaaaatgt
cccctccaggctgtggtgtcaatgcaagcattccaggccgcacaatttgtcagaccagaa
ttaaatgaggacgaagaagaatcagcactgcatcttggtcctgatacagttacagatgta
attgaggccgttgttcagagtgtaaacctgaacccagaacataagaagggattgaagagg
aagaattggctcttagaagaacagacaaggaaaaagcagaagccattaccagaagaagaa
gaagaagaagagaataataaaagctttactgaagcaccagttgagattcccagtcctcct
gaaaccccagccaaacctcccgaacctgaaagtaccttgcagcctgtgctctctctcatc
ccaagggaaaagaaggccccacgtcccccaaagaagaagtatcagaaagcagggctgtat
tctgacgtttacaaaactacagacccaaagagccgattaatccaattaaagaaagagaag
ttggaatatactccaggagagcatgaatatggcttattcccagcccccattcacgttgga
aagtatctaagacaaaagagaattgacttccagcttccctatgacatcctctggcagtgg
aaacacaatcagctgtacaaaaaaccagatgtcccactatataaaaaaatccgttcaaat
gtctacgttgatgtcaagcctctttctggttatgaggctacaacctgtaactgtaagaag
cctgatgacaacaccgggaagggctgcatggatgactgcctcaatagaatgatcttcgct
gaatgttctcccaacacttgcccctgtggtgagcaatgctgtaaccagaggatacagagg
catgagtgggtgcaatgtctagaacgatttcgagctgaagagaaaggttggggaatcaga
accaaagaaccactaaaggctgggcagttcatcattgaatatctaggggaggttgtcagc
gaacaagagttcaggaacaggatgattgagcagtatcataatcacagtgaccattactgt
ctgaatctggatagcgggatggtgattgatagttaccgaatgggaaacgaagcccgattc
atcaaccacagctgtgacccaaattgcgaaatgcagaaatggtctgttaatggagtatat
cggattggactgtatgctcttaaagatatgcctgctggaactgaactcacttatgattat
aactttcattccttcaatgttgaaaaacagcaactttgtaagtgcggctttgagaaatgt
cgagggatcataggaggcaagagccagcgcatgaatggactcaccagcagcaaaactagc
cagcctatgaccacacacaaaaaatctggacggtcaaaagagaagagaaaatctaagcac
aagctgaagaaaaggagaggccatctctctgaggagcccagtgaaaacatcaatactcca
acgaggttggctccccagttacagatgaagcctatgtccaaccgagagaggaactttgta
ttaaagcatcatgtgttcttggtccgaaactgggaaaagattcgtcagaaacaagaggaa
gtaaagcacaccagtgataatatccactcagcatcattgtatagtcgctggaatggtatc
tgccgagatgatgggaatataaagtccgatgtcttcatgacccagttctccgctcttcag
acagctcgatctgttcgaacgagacggttggcagctgcagaggaaaacattgaagtcgct
cgggcagctcgcctagcccagatcttcaaagagatttgtgatggtatcatcgcttataaa
gattcttcccggcaagcactggctgctccattgttgaaccttcccccaaagaaaaagaat
gctgattattatgagaagatctctgatcccctagatcttatcaccatagagaagcagatc
ctcattggttattataagacagtggaagcttttgatgctgacatgctcaaggtctttctg
aatgccgaaaagtactacgggcgtaaatccccaattgggagagatgtctgccgcctacga
aaggcctattacaatgcccgccatgaggcatcagcacagattgatgagattgtgggagag
acagcaagtgaggcagacagcagtgagacctcggtgtcagagaaggagaatgggcatgag
aaggacgatgacgttatccgctgcatctgtggcctctacaaggatgaaggcctcatgatc
cagtgtgacaagtgcatggtgtggcagcactgtgactgtatgggagtgaactcagatgtg
gaacactacctttgtgagcagtgtgacccaaggcccgtggacagggaggtacccatgatc
cctcggccccactatgcccaacctggctgtgtctacttcatctgtttgcttcgagatgac
ttgctgcttcgtcaaggggactgtgtgtatctcatgagagatagtcgacgtacccctgac
ggccaccccgtccgtcagtcctaccgactgctatctcacattaaccgagataaacttgac
atcttccgcatcgagaagctttggaagaatgaaaaagaggaacggtttgctttcggtcat
cattatttccgtccccatgaaacccatcactctccatcccgtcggttctatcacaatgaa
ctatttcgggtgccactctatgagatcattcccttagaggctgtagtggggacctgctgt
gtgttggacctttatacatactgtaaagggagacccaaaggagtgaaggagcaagatgtg
tacatttgtgattatcgacttgacaagtcagcacacctgttttacaagattcaccggaac
cgctatcctgtctgcaccaaaccctatgcctttgatcacttccccaagaagctcactccc
aaaagagatttctcacctcactatgtcccagacaactacaagaggaacggagggcgatct
tcctggaagtctgagcgttcaaagccaccccttaaagacctgggccaggaagatgatgct
ctgcccttgattgaagaggttctagccagtcaggaacaagcggccaatgagatgcccagc
ctggaggagccggaacgggaaggggccactgccgaagtcagtgaagttgaaaaaaaaaca
gaggactgtagtcaagaatcccaatcagcctgcacccctgcggagcgacggcataaccaa
cgggaacggctcaaccagatcttgctcaatctccttgaaaaaatccctgggaaaaatgcc
atcgacgtgacctatttactggaggaaggatcaggcaggaaactgcgaaggcgtacgttg
tttatcccagaaaactgctttcggaagtga

DBGET integrated database retrieval system