KEGG   Tupaia chinensis (Chinese tree shrew): 102480658Help
Entry
102480658         CDS       T02978                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:tup00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    102480658
   04614 Renin-angiotensin system
    102480658
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    102480658
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    102480658
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102480658
Peptidases [BR:tup01002]
 Metallo Peptidases
  Family M2
   102480658
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102480658
CD molecules [BR:tup04090]
 Proteins
  102480658
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 785 aa AA seqDB search
MGTKWIRPRPSLLVLLCYGQLLPWLRAEGDLSLSTAGTQSSLGPDKGTKQAGADSSPNET
PTSFPAANFYNESEARKFLAFYEQTAQLVLNQFVEATWNYVTNITRTNQENMLHKEVEKS
QFMMYFGSRARLFKTAQLQDLDVKRALSKLQDIDKAALPKDELWEYNKLLADMETTYSMA
QVCLNEGPCMSLEPELEDIMANSRDQKELLWAWQGWRDAVGRLIRTSFERYVQLSNKVAQ
LNGYNDMGALWRARYEGALGRAGYEWDTLEQDLEQLFQELQPLYLNLHAYVRRALHRHYG
PEHINLRGPIPAHLLGNMWAQSWINILDLALPFPEKPPEDITKIMKAQHWNAEKMFEEAE
KFFTSLGLLPVPPNFWEKSMFERPTDGREVECHASAWDFYNGKDFRIKKCTEVTIEDLLS
IFHQMGHIQYFLQYKNLSVTFRTGANPAFEEAVGSVITLSASSHKHLVFRGLLSHQHQDS
EEEVNFLMGIALDKIVFIPFGYLMDLFRWKVFDGTIHKDIYNQEWWNLKLKYQGLCPPVP
RSEEDFDPAAKFHISASEPYMRYFLSLVLQFQIHEALCTASGHVGPLHRCDIYNSKAAGE
LLADALKLGSSKPWPEVLEKLTGQSEVSTKALMTYFKPLLNWLVAENVRQGDILGWPDFS
CSFEEKETDKMRFLGLELEPDQASSGQWVLLVLNLFLLLVTLGLGFRLYFLEKQSLAEDS
DASITMPKAYFLGLRMEPHLVARRQWMMLGLSFILMLCSIGLAIRVFTQHNGKPPWMKTE
WWSSD
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atgggaacaaaatggattcgcccaagaccttccctacttgtgctcctctgttatgggcag
ctcttgccatggctcagggccgagggcgatctgagcttaagtacagctgggacccaaagc
agcctgggaccagacaaagggactaagcaggcaggggcagactcctccccaaacgagacg
cccacctccttccctgcagctaacttctacaatgagtcggaggcgaggaagttcttggcg
ttttacgagcaaacagcccagcttgtgttgaaccagtttgtggaggccacttggaactat
gtcaccaacatcaccaggacaaatcaggagaacatgctgcacaaggaagtggagaagtcc
cagttcatgatgtactttggcagccgagctcgcctgtttaagacggcccagctccaagac
ctggatgtgaagcgtgcgctgagtaagctgcaggacatagacaaggcggccttgcccaag
gacgagctctgggagtacaacaagcttctggccgacatggagacgacatacagtatggcc
caggtgtgcctgaacgaggggccctgcatgtccctggagcctgagcttgaagacatcatg
gccaactccagggaccagaaggagctgctgtgggcctggcagggctggcgggatgcagtg
gggcgcctgatccgcacctccttcgagcgctacgtgcagctcagcaacaaggttgcacag
ctcaacggttacaacgacatgggggccttgtggcgtgcccggtatgagggggccttgggg
cgtgccgggtatgagtgggacactctggagcaggacctggagcagctcttccaggagctg
cagccgctctacctgaacctgcacgcctacgtgcgccgggccctgcaccgccactacggg
cccgagcacatcaacctgagggggcccatccctgctcatctgctggggaacatgtgggct
cagtcctggatcaatatcttagacctggccctgcccttcccggagaagcccccagaggac
atcacaaaaatcatgaaagcccagcactggaatgcagagaaaatgtttgaagaagctgaa
aaattcttcacctccttggggctgctgcctgtcccacccaatttctgggaaaagtcgatg
tttgagcggcctacggacgggcgggaggtggagtgccacgcctcggcctgggacttctac
aatggcaaggacttcaggataaagaagtgcaccgaggtgaccatagaggacctgctctcc
atcttccaccagatgggccatatccagtacttcttacagtacaagaacctctctgtgacc
ttccgcacaggcgccaacccagccttcgaagaggccgtggggtctgtaatcaccctctcg
gcctcctcccacaagcacctggttttcagaggcctgctcagccaccagcaccaggactca
gaggaggaggtcaacttcctgatgggcatcgccctggacaagatcgtcttcatccccttt
ggctacctcatggacctctttcgctggaaggtctttgatggcaccatccacaaggacatt
tacaaccaggagtggtggaacctcaagttgaagtaccagggcctgtgcccccccgttcct
cggtcagaggaggacttcgatccagctgctaagttccacatttctgccagcgagccctac
atgcggtacttcctcagtctcgtgctccagttccagatccatgaggcactgtgcacagcc
tcgggccatgtgggtcccctgcaccggtgtgacatctataactccaaggcagccggggag
ctcctggcggatgccctaaagctgggctcgagcaagccttggccagaggtcctagagaag
ctgaccgggcagtccgaggtatctacaaaggccctaatgacctacttcaaacccctgctg
aactggctggtggcagagaacgtgcgacagggagacatcctcggctggccagacttcagc
tgctcctttgaagaaaaagaaaccgacaaaatgcgctttctgggtttggagctcgaacct
gaccaggcctcatctgggcagtgggtactgctggtcctgaacctcttcctgctcctggtg
accctggggttaggcttcaggctgtacttcctagaaaagcagtcactggctgaggactca
gacgcatccatcacaatgcccaaagcctacttcctgggcctacgcatggagccccacctg
gttgccagaaggcagtggatgatgctgggcctcagcttcatcctgatgctgtgctcaatc
ggcctggccattcgggttttcacacagcacaatgggaagcctccgtggatgaaaactgag
tggtggagctcggactag

DBGET integrated database retrieval system