KEGG   Tupaia chinensis (Chinese tree shrew): 102497899Help
Entry
102497899         CDS       T02978                                 

Definition
(RefSeq) cationic trypsin-3
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
tup  Tupaia chinensis (Chinese tree shrew)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:tup00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102497899
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    102497899
   04974 Protein digestion and absorption
    102497899
 Human Diseases
  Infectious diseases
   05164 Influenza A
    102497899
Enzymes [BR:tup01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102497899
Peptidases [BR:tup01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102497899
Exosome [BR:tup04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102497899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 247 aa AA seqDB search
MKTLIFLALLGAAVAFPTNDDDDKIVGGYTCQKNSLPYQVSLNAGYHFCGGSLISDQWVV
SAAHCYKSRIQVRLGEHNIDVLEGDEQFINSAKVIRHPKYNSATIDNDIMLIKLSSPATI
SSRVSTVSLPRSCAAAGTQCLISGWGNTLSSGTNYPELLQCLKAPILSASVCSNAYPGQI
TSNMICLGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKGKPGVYTKVCNYVDWI
KQTIAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctcatctttcttgctctcctgggagctgctgttgctttccccactaatgat
gatgatgacaagatcgttgggggctacacctgtcaaaagaattccctcccctaccaggtg
tccctgaatgctggctaccacttctgcggtggctccctcatcagtgatcagtgggtggtg
tccgcagctcactgctacaagtcacgaatccaggtgcgtttgggagaacacaacattgac
gttcttgagggtgatgagcaattcatcaattcagccaaggttatccgccaccccaaatac
aattcagccaccattgacaacgacatcatgctgattaaactgagctcaccagccaccatc
agctctcgagtgtctacggtttctctcccaagatcctgtgcggctgctggtactcagtgc
ctcatctctggctggggaaacaccctgagcagcggcaccaactaccctgagctcctgcag
tgtctgaaggccccaatcctctctgcctctgtttgcagcaatgcctacccaggacagatc
accagcaacatgatctgtctgggattcttggagggtggaaaggactcctgccagggtgac
tctggtggccctgtggtctgcaatggagaactccagggaattgtctcctggggctatggc
tgtgctcagaaaggcaaacctggtgtctacaccaaggtctgcaactacgtggactggatt
aagcagaccatcgctgccaactaa

DBGET integrated database retrieval system