KEGG   Tetranychus urticae (two-spotted spider mite): 107367269Help
Entry
107367269         CDS       T04901                                 

Definition
(RefSeq) hexokinase-2-like isoform X1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tut00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107367269
   00051 Fructose and mannose metabolism
    107367269
   00052 Galactose metabolism
    107367269
   00500 Starch and sucrose metabolism
    107367269
   00520 Amino sugar and nucleotide sugar metabolism
    107367269
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107367269
Enzymes [BR:tut01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107367269
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 454 aa AA seqDB search
MSYSIELSKIEAITRNLVLTNDQLEKVASLLLNEFNEGLGKQTHPSASVKMFPTYVRDVP
NGRGKYEEGKFLALDLGGTNFRVLLIDINGDAFHMENEIYAIPQEIMLGTGEQLFDHIAS
CLSQFVEKRNMKNCRLPLGFTFSFPCIQEGLIRARLVQWTKGFKCAGVEGRDVVQLLRDA
IKRRSDVDIDVMAVVNDTTGTLMSCAHKNRECRVGLIVGTGTNACYMETLDNVELWNEEI
DDPRQVIVNTEWGAFGDNGVLDFIRTKWDEEIDVNSLNPGKQLFEKMISGMYMGELCRVI
LADLTRRGLIFEGEGSEKLFTPWGFKTAYISFIESDSKHSYTETRKALEELDLTNVSNED
CEALKLVSARVSTRAAYLVSAAVATILNKIRRPHTTVGVDGSVYRYHPHFHDLMERKIAD
LVHPEYKFDLMLSEDGSGRGAALVAAVAVRQPTR
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtcatattccattgagctttccaagattgaagccatcacccgtaacctagttttaact
aatgatcaacttgaaaaggttgcttctctccttttaaatgaattcaacgaaggactcgga
aaacaaacccatcctagcgcctcggttaaaatgttccccacttatgttcgcgatgtgcct
aacggacgtggtaagtacgaggaaggtaaatttttagccttggatctcggtggaactaac
ttcagagtccttctaattgacattaatggtgacgcgtttcatatggaaaatgaaatctat
gctataccacaggaaattatgcttggaaccggcgaacagttatttgatcatattgcatcc
tgcctttctcaatttgttgaaaaacgtaacatgaaaaattgccggcttccacttggtttc
accttcagtttcccgtgtattcaggaaggcttaatccgagccagacttgttcaatggact
aagggtttcaagtgtgctggagttgaaggaagagatgttgttcaactccttcgtgatgcc
atcaaaaggcgatcggatgttgacattgatgttatggccgttgttaatgataccactgga
actttaatgtcatgtgctcacaaaaaccgtgaatgtagagtaggattgatagtaggtact
ggaactaacgcatgttatatggaaactctcgataacgttgaactttggaatgaggaaata
gatgatccacgtcaagttatagtgaatactgaatggggtgcattcggtgacaacggagtg
ttagatttcattcgaacgaaatgggatgaagaaatcgatgtcaattccctcaatcccgga
aagcaattatttgaaaagatgatttctggaatgtatatgggtgaactttgtcgagttatt
ctagccgatttaacacgcagaggtctcatttttgaaggagaaggatcagaaaagttgttc
acaccctggggcttcaagacagcctacatttcattcattgaaagtgactctaaacacagt
tatactgaaacacgtaaggctcttgaagagcttgatttgactaacgtttcaaacgaagac
tgtgaagcattaaagttggtctcagcacgagtttcaacaagagcagcatacttagtgtct
gcggctgttgcaaccattctcaacaaaattcgtcgacctcacacaactgttggagttgat
ggttcagtgtatcgttatcatcctcacttccatgacttgatggagagaaaaattgctgac
cttgttcatccagagtacaaattcgacctgatgttatctgaagacggtagtggtagaggg
gcagctttagtagccgctgtagccgtcaggcaacctaccaggtaa

DBGET integrated database retrieval system