KEGG   Tetranychus urticae (two-spotted spider mite): 107370109Help
Entry
107370109         CDS       T04901                                 

Definition
(RefSeq) annulin-like
  KO
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
tut  Tetranychus urticae (two-spotted spider mite)
Brite
Enzymes [BR:tut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     107370109
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 761 aa AA seqDB search
MGQSCSSCLRSLIDGRRYRFPSSSHRPEPIRKMDPYALNVRSVDLLVERNTKKHYTDLYE
TTKHPFDGNLVARRGSSFQIRILFARETTIGSDVVNLIFRVADSKRPMYSEGTEITLPVG
DENMNEINPLSRPWEVSILSWETKSATLEITPAINTIIGEWKLSIETRSIVSGRNHYSTF
QVPASIYILFNPWNKNDLTYLWNDKEREEYVLNDYGIIWKGTHSRLRPSPWSYAQFEDKI
LECSILILTSLGNLPISDRANPIKVVRHLTRVIHNHNVFDGYGVLVGRWDGKYKSGTDPT
KWIGSRPILQEFYSNRKPVKYAQCWVFAGVLTTVCRCLGIPARPVTNYDSAHDTQASLTV
DVIVDDKLGVIDELTKDSVWNFHVWTEVWLKRPDLSFTGVYDGWQVIDATPQEPSDGIYQ
CGPTSVVAIRNGEITRDYDGRFVFAEVNADEVYWLRTGAEESYKYLQSDITKIGKNLSTK
QVGANDRIDLTSNYKHQEETPEEREIMIKALHQSNNIFTKYYLNAKFSDIRFDLQLLDDV
LIGKPFKVRLIAENKSGLVYTVETLTRLDTVFGDGKRNKEIKRDLSLTKIPPLSEVEIAI
PIEYEDYENHLVDQNTFSVVMIAKVLENDYHYAGIDNFRLRMPDIEIEVVGDVFEKKPFT
CHAYFKNPLPKRLNKGIFLIEGPGLVKPNQTLKIPLKRSVKADDWARVTFTLTPTTIGEK
TIIVKFYSKELKDIDGSRIVRVSRDTTLFNLDELDERFRRT
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgggccaatcttgttcatcatgccttcgctcattgatcgatggaagacgttatcgtttt
ccgtcttcctctcatcgtcctgagcctatccgtaaaatggatccttatgcgttaaatgtg
cgatcagtggacctgttggttgaaaggaatacaaagaaacattatacagatttgtatgag
acaactaaacatccatttgatgggaatcttgtggctcgccgaggatcatcatttcaaatt
aggattttatttgcaagagagacaacaattggttctgatgtggttaacctcatctttaga
gttgcagactcaaagagacccatgtacagtgaaggaactgaaattacattacctgttggc
gatgaaaatatgaatgaaatcaatcccttatcacgaccatgggaagtctccatactttca
tgggagaccaaatcagcaactcttgagattacaccagcaattaacacaattattggagaa
tggaagttatcaatagaaacaagatccattgtttctggaaggaaccattattcaacattt
caagttcctgccagtatttacatactttttaatccttggaataaaaacgacttaacttat
ctctggaatgataaagaaagagaagagtatgttcttaacgattatggaataatatggaaa
ggaactcattcacgattaaggccgagtccatggagttatgcacagtttgaagataaaatt
ttggaatgttcgatactgattttaaccagccttggtaatttaccgatttctgatcgagct
aacccaatcaaagtagttcgccatttaactcgagtaattcacaaccacaatgtatttgat
ggttatggtgttctcgtagggcgttgggatggtaaatataaaagtggaacagatccaacc
aagtggattggtagtcgtcctattttacaagaattttattcaaatcgtaaaccagtcaaa
tacgctcaatgctgggtatttgctggtgtcttaaccacagtttgtcgatgtcttggtatt
cctgctcgaccagtcacaaattacgattcagcacatgatacccaggcttctttgacggtt
gatgtaattgttgatgacaaacttggcgttatcgatgaattaaccaaagattcagtctgg
aattttcatgtatggacagaagtttggttgaaaagacctgatctatcttttaccggagtt
tacgatggatggcaagttatcgatgctacacctcaagaaccatctgacggtatttaccaa
tgtggacctacaagtgtcgttgcaatccgcaacggcgaaataacacgagattacgatggt
cgatttgttttcgctgaagttaatgcagatgaagtttactggttgaggactggagctgaa
gagtcttacaaataccttcaatctgacattacaaaaattggtaaaaatctttcaactaaa
caagttggagccaatgatagaatcgatttaacttcaaattataaacaccaagaagagact
cccgaagaaagagaaataatgatcaaagccttacaccaaagtaataatattttcaccaaa
tattatttaaacgctaaattcagtgatatccgatttgatttgcaacttctcgatgatgta
ttaattggtaaaccattcaaggttcgtttgatcgcggaaaataaaagtggtcttgtttat
accgttgaaacccttacacgacttgatacagtatttggtgatggcaaacgaaacaaggaa
attaaaagagatttgagcttaactaaaattcctcctctttctgaagttgaaatagctata
ccgatcgagtatgaggattatgagaatcatttggttgatcaaaataccttttctgttgtc
atgattgccaaagtgctggaaaatgactatcattatgctggtatcgacaatttccgccta
agaatgcccgatatcgaaatcgaagttgttggtgacgtattcgagaaaaagcctttcact
tgtcatgcatattttaaaaatccactaccaaagagactaaataaaggcatctttttgatt
gaaggacccggattagtaaaaccaaatcagacacttaaaataccattgaaaagatctgta
aaagcggacgattgggctcgagttaccttcaccttgactccaacaacaattggagagaaa
actataatagttaaattttattcgaaagaattgaaagatattgatggctctcggattgtt
cgcgtttcaagagatacaactctatttaatttagatgaattggacgaaaggtttcgaaga
acctga

DBGET integrated database retrieval system