KEGG   Trichophyton verrucosum: TRV_00718Help
Entry
TRV_00718         CDS       T01615                                 

Definition
(RefSeq) glutathione S-transferase, putative
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
tve  Trichophyton verrucosum
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    TRV_00718
Enzymes [BR:tve01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     TRV_00718
Transporters [BR:tve02000]
 Other Transporters
  Pores ion channels [TC:1]
   TRV_00718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 237 aa AA seqDB search
MAPRDIKPLVLYGIYPTANPVKVAIILEILNIPYELKSTDFRQCKEPEYLAINPNGRCPA
IHDPNTGLYLWESGAIVEYLVDEYDKENTISFSSLHEKYHLRQWLHFQVSGQGPYIGQFS
WFKWYHVEKFPSAVDRYAKETRRVMGVVDLGLKDKEWLVGGKMTYADICLVPWFFWAKRI
GGDEWYAEQVSELPNFQKWWNKIIEVPKIKEFCAGIAQFDPSYVPKDVLDRLNNETA
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggctccccgagacatcaagccgttggttctctacggcatctaccccacagccaacccc
gtcaaggtggccatcatcctcgagatcctgaacatcccctatgagctcaagtctaccgac
ttcagacagtgcaaggagcccgagtacctcgccataaaccccaatggccgctgtcctgct
atccacgaccctaacactggcctctatctctgggagtctggtgccattgtagagtacctt
gttgacgaatacgacaaggagaacaccatctctttctcttcgctgcacgagaaataccac
ttgagacagtggctgcatttccaagtcagtggtcaaggcccatatatcggccaattctca
tggttcaaatggtatcacgtcgagaagttcccgtctgctgttgacagatatgctaaggag
acccgtcgtgttatgggtgtcgtcgacttgggattgaaagacaaggagtggcttgttggt
ggtaagatgacctacgccgacatttgcttggttccatggttcttctgggcaaagagaatc
ggcggagacgagtggtatgccgaacaagtttccgagcttcccaacttccagaagtggtgg
aacaagattatcgaagttccaaagatcaaggagttctgcgctggcattgcacagttcgac
ccatcatatgtcccgaaggatgttctggacagactgaacaacgagactgcctaa

DBGET integrated database retrieval system