KEGG   Trichophyton verrucosum: TRV_01358Help
Entry
TRV_01358         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
tve  Trichophyton verrucosum
Pathway
tve00250  Alanine, aspartate and glutamate metabolism
tve00410  beta-Alanine metabolism
tve00430  Taurine and hypotaurine metabolism
tve00650  Butanoate metabolism
tve01100  Metabolic pathways
tve01110  Biosynthesis of secondary metabolites
Module
tve_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:tve00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    TRV_01358
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TRV_01358
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    TRV_01358
   00430 Taurine and hypotaurine metabolism
    TRV_01358
Enzymes [BR:tve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     TRV_01358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC DUF917 DUF3715 Aminotran_5 N1221
Motif
Other DBs
NCBI-GeneID: 9579750
NCBI-ProteinID: XP_003024527
UniProt: D4D2Q2
LinkDB All DBs
AA seq 791 aa AA seqDB search
MSLAWRIGRCIARANATNTISTVAEQMIDEVGGPESGKILFRGKIVAVERRLFKGHSYGE
ITIQQVLKKEVESSVADELSGDARRSLTPVATGGVLKIPFKNENIYAKHISDEGVEKYVA
TVPDLICVLDTQSGKALGVPEFRYGVMVTVLGIACSPRWSDTERALEIGGPGAFGYKDIK
YVPLGKYVEPKSVVTEYAERLDIYSTEKEEQAKITPRTYVDPDDIIKHFREDFDKEQERE
ASAIFTSNAVSSVTPYSTRYSSKEEIPKFKIPKLGARADAVHHMLSNELDLDGIPNLNMA
RYMRPSATVDSLKKVTANNCLAYSFVGTYMDREANQLVVENISKNLADADEYPALMAIHA
RCISIISNLWNPQPGEEATGSATTGSSEAIMLGGLAMKKKWQQKRKDEGKDISNPNIIMG
SNAQVALLKFARYFDVEARVLDVSEKSQFRLNPELVKKNVDENTIGIFVILGSTYTGHYE
PVEEISNILDGIQSETGIDVPIHVDAASGGFVAPFTDAGAGGPKWYSINASGHKYGLVYA
GLGWIIWRDRSYLPKELIFELDYLGSREETYTLNFSRPGAQVIGQYYNFIRLGFNGYREI
MENCLANARLLSKTLERTGWFVCLSDIHRKKGEFYHQHLNKITPYKEDETSADYNAGLPV
VTFRFSDAFKENYPHVKQESISLLLRSKQYIIPNYPLPPKEQDTEILRVVVRESMAADLI
DKLVADIAAVTERLMKSDPVDLSALQTGPTNLERRRVRNREQPHKVSKRPSGKKEKTAGH
PMRSGIHRSVC
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgtcccttgcgtggcgtattgggcgttgcatcgcgcgtgcaaatgctaccaacaccatt
agcaccgtggctgaacagatgattgacgaggttggcggtcctgaatctggtaagattctc
ttccgaggaaagatagttgccgtggaaagacgactattcaagggccattcatatggcgaa
atcacaattcaacaagtccttaaaaaagaagtcgagtcaagtgtagcagacgagctctca
ggagatgcaaggcgatcattgacacctgtggccaccgggggtgtcctaaagatccctttc
aagaacgaaaatatctatgccaaacacatttccgacgaaggcgtcgagaaatatgtggca
acagtgcctgatctgatctgcgtccttgacacacagtctggaaaggcgcttggggtcccc
gaattcagatatggtgttatggtaactgtgttgggaattgcatgttcccctcgatggtca
gataccgaaagagcactggagattggtgggccaggggcgtttggatataaggatatcaaa
tatgttcccttgggtaaatacgtagagcccaaaagtgttgtgacggaatatgcagagcga
ctagatatatattcgactgagaaggaggaacaggccaagataacaccgaggacttatgtt
gatcctgatgatatcatcaaacactttcgagaagatttcgacaaagaacaggagcgggaa
gcttctgccatctttacctcaaatgcggtctcgtctgtaacgccgtattcaacgagatat
tctagcaaagaggagatacctaaattcaagatccctaagctgggtgctcgcgcagatgcg
gtgcaccatatgctgagcaatgaactcgatctagatggtatcccgaatttgaacatggca
aggtacatgcgacccagcgctaccgttgattccctcaagaaagtaactgctaataattgt
ttggcatatagtttcgttggtacttacatggaccgagaagcaaatcaacttgtggttgag
aatatcagtaagaatctagcggatgcagatgaataccctgcgttaatggctatacacgca
agatgtatatccataatatccaatctatggaatccacaaccaggagaagaagccaccgga
tctgcgacaactgggtcctctgaagccatcatgttgggtgggctggccatgaaaaagaag
tggcagcagaaacgtaaggatgaaggaaaggacatctctaatccaaatatcatcatggga
tcaaacgctcaggtagctctcctgaagttcgccaggtactttgacgttgaagctcgagtt
ctggatgtatccgagaagagccaatttcgtctcaacccagagttggttaagaaaaatgtg
gacgagaataccattgggatatttgtgatccttggaagcacctatactggtcactatgaa
cctgtcgaagagatatctaatatcctggatggcatacagtccgaaaccggtatagatgtc
cctattcatgttgatgctgccagcggtggatttgtggcaccattcactgacgcaggggct
ggagggccaaagtggtattcaatcaatgcatccggacataagtacggtctcgtgtatgca
ggattgggttggataatctggcgagaccgctcctatctgccaaaagagctcattttcgag
cttgattatctcgggagcagagaggagacttatacattgaacttctccaggcctggagca
caggtaattggccagtactataacttcatccgccttgggttcaatgggtatcgagaaatc
atggaaaactgtttggcaaatgcaagactgctgagcaaaactttggaacggactggatgg
tttgtctgtttgagcgatatccaccggaagaaaggggaattctaccaccagcatctgaac
aaaattacgccctataaggaggacgaaacatctgctgactataacgctggtttgccagtg
gtaacattccgattctcagatgcattcaaagagaattatccccatgtgaagcaagagagc
ataagcctcctgctgaggtcgaagcagtatataattcccaactaccctttacctcccaaa
gagcaggacacggagattctgcgggtggttgtccgggagagcatggccgcagacctcatt
gacaagcttgtggcagatattgctgcagtcaccgagaggctgatgaaatccgaccctgtc
gacctgtctgcactccagacaggcccaaccaaccttgagcggcgtcgagtaagaaacaga
gagcagcctcacaaggtctcgaagcggccaagtggaaagaaagaaaagactgcaggccat
ccgatgagaagtggaatccaccgctccgtttgttag

DBGET integrated database retrieval system