KEGG   Trichophyton verrucosum: TRV_07105Help
Entry
TRV_07105         CDS       T01615                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tve  Trichophyton verrucosum
Pathway
tve04011  MAPK signaling pathway - yeast
tve04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tve00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TRV_07105
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    TRV_07105
Enzymes [BR:tve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TRV_07105
Protein kinases [BR:tve01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   TRV_07105
Chromosome and associated proteins [BR:tve03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     TRV_07105
Exosome [BR:tve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TRV_07105
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH
Motif
Other DBs
NCBI-GeneID: 9580051
NCBI-ProteinID: XP_003018879
UniProt: D4DIU4
LinkDB All DBs
AA seq 379 aa AA seqDB search
MVQPAPNGGSRKISFNVSDQYDIQDVIGEGAYGIVCSAVHKPSGQKVAIKKITPFDHSMF
CLRTLREMKLLRYFNHENIISILDIQKPRNFESFTEVYLIQVRVIQYGSYRCMNRINTLS
QELMETDMHRVIRTQDLSDDHCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLK
VCDFGLARSAASTDDNSGFMTEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSG
KPLFPGKDYHHQLTLILDILGTPTMEDYYGIKSRRAREYIRSLPFKKKIALKAIFPRTSD
LALDLLEKLLAFNPVKRITVEEALRHPYLEPYHDPEDEPSADPIPEEFFDFDKDKDTLSK
EQLKRTLNLLCRLLFLTVN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggtccagccggctcccaacgggggctcgaggaagatatccttcaacgtctctgatcag
tatgatatccaggatgtgataggcgagggagcgtacgggatcgtctgctctgctgtacac
aagccatcaggtcagaaagttgccatcaagaagatcacacctttcgaccactccatgttc
tgtcttcgcactctacgagagatgaaactacttagatatttcaaccacgagaacattata
tccatccttgacattcagaaaccccgcaactttgagagcttcaccgaagtctaccttatt
caggtacgagttattcaatatgggagttatcgttgcatgaatcgtattaacacgctgtcg
caggaattgatggaaactgacatgcaccgagtcatccgtacccaagacctttctgacgac
cactgccaatacttcatctatcagaccctaagagcacttaaggccatgcactctgccaac
gtgctccaccgtgatttgaaaccgtccaacttgctcctcaatgcaaactgcgaccttaaa
gtttgcgactttggacttgctcgctctgctgcctcaacagacgacaactccggattcatg
actgaatacgttgcaacccgttggtaccgcgccccagaaatcatgttaacattcaaagaa
tacaccaaagccatcgatgtttggagcgtgggctgcattctagctgaaatgctcagcggc
aaacccctcttccctggaaaggactaccaccaccaattaaccctcatcctggacatcctt
ggaacgccaacgatggaggattattacggaattaaatcccgccgtgcacgagaatatatt
cgttccctaccattcaagaagaagattgcgctgaaagccatattccccaggacttctgat
ctggcattagatctattggagaaacttcttgcctttaaccctgtcaagcgcatcacagtt
gaagaagcactgcgtcacccttacctggaaccctaccatgacccagaggatgaaccctct
gcggatcccatcccagaggagttcttcgattttgataaggataaggacacactgagcaag
gagcagctcaagcgtacgttgaatctcctctgccgcctattattccttacagtcaactaa

DBGET integrated database retrieval system