Thioalkalivibrio versutus: TVD_06725 Help Entry TVD_06725         CDS       T03959                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tvr  Thioalkalivibrio versutus Pathway tvr01100   Metabolic pathways tvr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tvr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TVD_06725   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TVD_06725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 HLH TerB DUF1896 Motif Other DBs NCBI-ProteinID:  AKJ95071 UniProt:  A0A0G3G881 LinkDB All DBs Position complement(1452534..1452773) Genome browser AA seq 79 aa AA seqDB search MSSIEERVKKIVVEQLGVKEEDVTNAAGFVDDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQQAIDYINEHMKD NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagtagcattgaagaacgcgtcaagaaaatcgttgtcgagcagctgggtgtcaaggaa gaggacgtgaccaacgcggccggcttcgtcgacgacctgggtgcggattcgctggacacg gtggaactcgtcatggcgctcgaagaggaattcgaaaccgaaatcccggacgagcaggcg gaaaagatcaccaccgtgcagcaggcgatcgattacatcaacgagcacatgaaggactga

DBGET integrated database retrieval system