KEGG   Trametes versicolor: TRAVEDRAFT_64780Help
Entry
TRAVEDRAFT_64780  CDS       T04795                                 

Gene name
LDO2
Definition
(RefSeq) linoleate diol synthase
Organism
tvs  Trametes versicolor
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 1052 aa AA seqDB search
MSQFLSDVRSDIGDASSHAGSATLKGFAEFRDQIKKHMPFAEDVSTIESIIDGIKHLNSI
DDRKMLLEHVLVYLSQNSGHPLAKKLETATVQLLYLDLPHPPSTSIGPKYAYRTADGSYN
NPDMPDLGKAGMPYARSVQQTHPLPRNEMPDAGLVFDTLLRREKFVPHPAGLSSMMFSFA
ALVIHTVFRTSHKDVNINETSSYVDLAPLYGHNEDAQAKIRVFDGRGLLKPDTFAEDRLL
LLPPAVCVLLVLFNRNHNYIARKLLELNERGTYNDPNTLSQASDQLRAQEEDLFQTARLI
NCAWFASAVFSDYFSAILGLVREGNSWSLNPFEEIRNADHSLFERGRGNVCSVEFNCLYR
WHATTSEADEKWVEQLSEQLFPGRTVEQVTIEDFKSLAKTMSAKEPDVSHWTFGGLQRDA
KTNKFDDGALADILKNATEHPAGKFKARGTPYVMRLHEIMGIEQNRQWGVCSLNDFRKFL
GLKTYSSFIEWNSDPTIAAAAEKLYGNIDRLELYVGLQAEESKPVVPGAGLCPAYTISRA
ILSDAIALTRGDRFFTADYTPFNMTSWGFADCQRDPDGPGNGSILGRLLLRALPEHYTSD
STYTWFPLMTPPAMQTILTKLGDTKLYSCARPGGPEPVKVLGTYVDARQVLKDEKSFATG
FADRAGRLVRANGFFIASADPARAAREQRAMLDVLVGGEGGESAIRRFFFEKTRELILRE
SYTAVASPVRSVDIVRDVFKAVPIHWVCELTGIKLKTNDSDSHGDYTPAQLFDILADVYT
YLFLDVGAEHLTKLQRKVTAEVNTLLGHIRQQFGGSRLSLANIFETVSQIFTRQPKNSHD
TFTERLHALGYDAETQANAVLALLVGATVELSQEMVHVLNYYLDPLKPADVQALVSKPKR
DPRDDALLQGYVLEALRLDPTFRGVYRDSVTAVRLSQGSLQAKQRVFVDIATANSSSQAF
SNPDDVNANRGLEKYLVGDGAARCLGLDLSSKIVGEALRAVYSFPSVARGPGNSGMLKRY
EEDSAMTSRWSYLGSDQHLCPWATSMVVQYRV
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagttcctctccgacgtccgcagcgatatcggcgatgcttcgtcccacgctggt
tctgcgaccttgaagggctttgccgagtttcgtgatcagatcaagaaacacatgccgttt
gcggaagatgtgtctacaatcgagagcatcatcgacgggatcaagcacttgaactccatc
gacgaccgcaagatgctcctcgaacacgtcctggtgtacctgtcccaaaactccgggcac
ccgctggccaagaagctggagacggccactgtccagctcttgtacctggaccttccgcac
cccccgagcacatcaattggtcccaagtatgcgtatcgcaccgccgatggctcgtacaac
aacccggacatgcccgacttgggcaaggctggtatgccctacgcacgcagcgtgcaacag
acacatccgctcccgcgtaacgagatgccagacgcggggctcgtctttgacacgcttcta
cgccgcgaaaagttcgtgccgcatcccgccggcctttccagcatgatgttctccttcgcc
gcccttgttatccacaccgtcttccgcacgtcgcacaaggatgtgaacatcaacgagacg
tcgtcgtacgttgaccttgcgccgctgtacggccataacgaagacgcgcaggctaagatt
cgggtattcgacgggcgcgggctgttgaagcccgacaccttcgcggaggaccgcctcttg
ctcctcccgcctgccgtctgcgtgcttctcgtgcttttcaaccggaaccataactatatc
gctcgcaagctgctcgagctgaacgagcgtggcacatacaacgacccgaacaccctctca
caggctagcgatcagctgcgcgctcaggaggaggatctcttccagactgcgcggctgatc
aactgcgcgtggttcgcatccgcggtattctcggactacttttccgcgatcctgggcttg
gtgcgtgaggggaacagctggagtctgaacccgttcgaggagatccggaacgcggaccac
tcgctcttcgagcgcgggcgcgggaatgtgtgcagcgtcgagttcaactgcctgtaccgg
tggcacgcaacgacgtctgaggcggatgagaagtgggtcgagcagctgtcggagcagctg
ttcccgggccgcaccgtcgagcaggtgacgatcgaggacttcaaaagtctcgcgaagact
atgtcggcgaaggagcccgacgtctcacattggacgttcggcggcctacagcgcgacgcg
aagacgaacaagttcgacgatggagcgctcgcggatatcctaaagaacgccacggagcac
cccgcgggtaagttcaaggcccgcggcacgccctacgtcatgcggctgcatgagatcatg
ggcatcgagcaaaacaggcagtggggtgtctgctccctgaacgacttccgcaagttcctg
ggcttgaagacctattccagtttcatcgagtggaactccgacccaaccatcgcggctgcg
gctgagaagctatacgggaacatcgatcgcctggagctctacgtcggcctccaagccgaa
gagtccaagcccgtcgttccgggcgcgggtctttgcccagcatacacgatcagccgcgcg
atcctcagcgacgccattgcactcacgcgcggcgaccgcttcttcaccgcggactacacg
cccttcaacatgacctcctggggcttcgcggactgccagcgcgaccccgacgggcccggc
aacggcagcatccttggccgcctgctcctccgcgcgctgcccgagcactacacgagcgac
agcacgtacacgtggttcccgctcatgacgccgcctgcgatgcagacgatcctcacgaag
ttgggcgacaccaaattgtattcgtgtgcacgccccgggggaccagagcctgtgaaggtg
ctcggcacgtatgtggacgcgcggcaggtgctgaaggacgagaagagctttgcgacgggc
tttgcggaccgcgccgggcggctcgtgcgtgcaaatgggttctttatagcgtcggccgac
cctgcgcgggcggcgcgcgagcagcgtgcgatgctcgacgtgctggtcgggggtgagggc
ggcgagagcgcgatccgcaggttcttcttcgagaagacgcgtgagctcatcctgcgcgag
tcgtacaccgcggtcgcgtccccagtccggagcgtcgacattgtgcgggacgtcttcaag
gcggtccccatacactgggtgtgcgagctgacgggcatcaagctgaagaccaacgactcc
gacagccacggtgactacacgcctgcgcagttgttcgacatcttggcggacgtctacacg
tacctcttcctcgacgtcggtgccgagcacctgaccaagctgcagagaaaggttactgcg
gaggtcaacaccctcctcgggcacatccgccagcagttcggcggctcgcgcctctcactc
gccaatatcttcgagaccgtctcgcagatcttcacgcggcagccgaagaacagtcacgac
acgttcacggaacgcctgcatgcgctaggatacgacgccgagacgcaggcgaacgcggtg
ctcgcgctgctcgtcggggctacggtcgagctctcgcaagagatggtgcacgtgctgaac
tactacctcgatccgctgaagccggcggacgtgcaggcgctggtgtctaagccaaagcgc
gacccgcgcgacgatgcgctgctgcagggatacgtcctggaggcgctgcgcctcgacccg
actttccgtggagtctaccgcgacagcgtgaccgcggtgcgcttgagtcagggctcactt
caggcgaaacaacgcgtcttcgtggacattgccaccgcaaacagtagcagccaggcattc
tctaatccggacgacgtcaacgccaacaggggccttgaaaagtatctggttggcgacggc
gctgcaagatgcctcgggcttgatctgagttctaagatcgttggcgaagccttgcgggcg
gtgtacagcttcccgtctgtcgcgcgggggcctgggaactccggcatgctcaagcggtac
gaagaggactccgccatgacgagcagatggtcgtacctgggttccgaccagcacctctgc
ccgtgggcgacgtcgatggtggttcagtatcgcgtctga

DBGET integrated database retrieval system