KEGG   Thalassospira xiamenensis: TH3_12335Help
Entry
TH3_12335         CDS       T03639                                 

Definition
(GenBank) putative alanine racemase, catabolic
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
txi  Thalassospira xiamenensis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:txi00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    TH3_12335
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    TH3_12335
Enzymes [BR:txi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     TH3_12335
Peptidoglycan biosynthesis and degradation proteins [BR:txi01011]
 Precursor biosynthesis
  Racemase
   TH3_12335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2653430..2654551
Genome map
AA seq 373 aa AA seqDB search
MSVLPAAGRAAECAELQINLKAIADNYQIIKKRYKGRTCGAVVKADAYGLGAQTIVPVLK
KQGCRLFFVAQANEAADLFPLLRGGGRIAVLNGVLPGDEEFFIENDVIPVLNDLGQIERW
SNLCREHERPAPAFIHLDTGMNRLGLAPREIGELVDRYSSLLYGFEKAGYMTHPVAADEL
ENPVTAEQYELFMKWYRRLPPAPRGFCNSSAIFRNNDYHLEFCRPGFALWGGNPTPETTN
PMRPVVKLTAKVLQVRQIVAGEAVGYGGTWRAERASRIATVAVGYADGWLRSLSNSGKLR
IKGHEVPYVGRVSMDAISIDVTDLPGKPLQPGDMIPLIDDKMTVDDIASAAGTIGYEILT
SLGHRYRRVYTES
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttcttcccgccgccggccgtgctgctgagtgtgccgaacttcagatcaatctg
aaggcgattgctgacaactaccagatcatcaagaaacgctacaaagggcggacttgtggc
gcggttgtcaaagcagatgcttatggccttggcgcacaaaccattgtgcctgttctcaaa
aagcagggttgtcgtcttttctttgtcgcacaggcaaacgaagcagccgacctgttcccg
cttctgcgtggcggcggtcgcattgctgttctcaatggcgttctgcccggtgacgaagaa
ttctttatcgaaaatgacgtcattccggtgcttaatgaccttggtcagatcgaacgctgg
tcaaatctttgccgtgaacatgaacgccccgcaccggccttcattcatcttgataccggg
atgaaccgtttgggtcttgccccgcgcgagatcggcgaactggtggatcgttattcgtct
cttttatacggcttcgaaaaagcgggatatatgacccacccggtcgccgccgacgagctt
gaaaatccggtcacggccgaacagtacgaactgttcatgaaatggtatcgccgcctgccg
cctgctccgcgcggtttctgcaattcctcggcgattttccgtaacaacgattatcacctc
gaattctgccgtccgggctttgcgctttggggtggaaacccgacccccgaaaccaccaac
ccgatgcgtccggtggtaaaactgaccgcaaaggtacttcaggtgcgtcagatcgtcgct
ggcgaggcggttggttatggcggcacctggcgcgcggaacgagccagccgcattgcgaca
gttgccgttggttatgccgatggatggctgcgttcgctttcgaattcaggaaaactgcgc
atcaaagggcatgaagtcccgtatgtcggacgggtttcgatggatgcaatcagtattgat
gtcaccgatcttccgggcaagccgttgcagccgggcgatatgattccgttgattgatgac
aaaatgacagttgacgacatcgcaagtgctgcgggtacaatcggttatgaaatactgact
tctcttggacatcgctatcggcgggtctatacagaaagctga

DBGET integrated database retrieval system