KEGG   Thalassospira xiamenensis: TH3_17620Help
Entry
TH3_17620         CDS       T03639                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
txi  Thalassospira xiamenensis
Brite
Enzymes [BR:txi01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     TH3_17620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3843510..3844214)
Genome map
AA seq 234 aa AA seqDB search
MADLSAFDITKRWPAKNPDILQLYSLPTPNGVKVSIMLEETGIDYEPHFIDIGKDETWTP
EFLSLNPNGKIPAILDPNGPDGKPVGLFESGAILLYLAEKTGKFLPSDPIARIETIQWVF
FQMAAIGPIFGQLGFFHKFAGREYEDKRPRDRYVGESKRLLGVLETRLAGRDWIMGDEYT
IADIATLGWVRNLIGFYDAGALVDYDSLKNVPAWLERGLARPAVKRGLEIPARP
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctgtccgcatttgacatcaccaagcgatggccagcgaagaaccccgatatc
ctgcagctttattccctgccgacgccgaacggggtcaaggtttcgatcatgctggaagaa
accggcatcgattacgagccgcatttcatcgatatcggcaaggatgaaacctggacgccg
gaattcctttcgctgaacccgaatggtaaaattccggccattcttgatccgaacgggccg
gatggaaaaccggttggcctgtttgaatcgggggcaattcttttgtatctggcggaaaaa
accggaaaattcctgccatctgatccgattgcccggatcgaaaccatccagtgggtgttt
ttccagatggcggcgattggcccgatatttggtcaacttggctttttccacaaatttgcc
gggcgcgagtatgaggataaacgcccgcgggatcggtatgttggggaatccaaacgtttg
ctgggggttctcgaaacccgtcttgccgggcgtgactggatcatgggtgatgaatatacc
attgccgatatcgcgacccttggctgggtgcgcaatctgatcggtttctatgatgccggg
gcactggttgattatgacagtctgaaaaacgttccggcatggcttgaacgcgggcttgcg
cgaccggcggtcaagcgtggtctggaaattccggcgcgtccttag

DBGET integrated database retrieval system