KEGG   Thermoanaerobacterium xylanolyticum: Thexy_0579Help
Entry
Thexy_0579        CDS       T01505                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
txy  Thermoanaerobacterium xylanolyticum
Pathway
txy03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:txy00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Thexy_0579
Enzymes [BR:txy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Thexy_0579
DNA repair and recombination proteins [BR:txy03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Thexy_0579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AEF16630
JGI: Thexy_0579
UniProt: F6BHW1
LinkDB All DBs
Position
complement(607089..608012)
Genome map
AA seq 307 aa AA seqDB search
MSLMDEKISPMLAISGNVFDDPSWVYEIKWDGSRTIAFLSSTTKLQDRRLVDISHQFPEL
MEVNKCLKSNEAILDGELIVLKDNKPSYRNIMMRKHQQNKLKIELLSKYNPAIFITWDVI
YVDGKELLNYPLIKRKEILSKIVSEGNLIRISDYIFGQGKTLFAETGKKQLEGVMAKKAD
SKYYLGKRSSLWQKFKHHIILNAVILGYKIDKTALVLGLYNEDDKLVHIGNVESGISQKE
LSSFLEVANDLKVNPEFYGLAINNVQWIMPFIVCKVKFMEWSENFKMRAPSFLEFALDVK
PTECRFM
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgatggatgaaaaaatttctcctatgctggctatatcgggaaatgtatttgac
gatccaagttgggtgtatgaaatcaaatgggatggttcgagaacaatagcatttctttca
tctactacaaaacttcaagacagaaggctagtagatataagccaccaattcccagaactt
atggaagtaaataaatgtctaaaatcaaatgaagccatacttgatggcgagctaatcgtt
ctaaaagacaataaaccaagttatagaaacataatgatgcgaaaacaccaacaaaacaaa
ctaaaaatagaacttttaagtaaatacaatcccgcaatatttataacatgggatgtaata
tatgttgatggaaaagagctattaaactacccactgattaagcgcaaagaaattttaagt
aaaatcgtcagtgaaggcaatctaataaggatatctgattatatatttggacaaggcaaa
actttatttgcggaaactggtaaaaagcaactggaaggagtaatggctaaaaaggcagac
tcaaaatattacttagggaaaagaagtagtctatggcaaaaattcaaacaccacataata
ctaaacgctgtaatattggggtataaaatagataaaacagcgttagtcttgggtctttac
aacgaggatgacaaacttgtgcacattggaaatgtagaatctggaatatcgcaaaaagaa
ttatcatcattcttagaagttgccaacgatcttaaggtcaaccctgaattttacggtctt
gccattaacaacgttcaatggataatgccttttattgtatgtaaggttaaattcatggaa
tggtcagaaaatttcaaaatgagagcaccgtctttcttagaatttgccttagatgtgaaa
cctaccgaatgcagattcatgtaa

DBGET integrated database retrieval system