KEGG   Candidatus Uzinura diaspidicola: ASNER_249Help
Entry
ASNER_249         CDS       T02439                                 

Gene name
kgd
Definition
(GenBank) 2-oxoglutarate dehydrogenase (succinyl-transferring), E1 component
  KO
K00164  
2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
udi  Candidatus Uzinura diaspidicola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:udi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ASNER_249 (kgd)
  Amino acid metabolism
   00310 Lysine degradation
    ASNER_249 (kgd)
   00380 Tryptophan metabolism
    ASNER_249 (kgd)
Enzymes [BR:udi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     ASNER_249 (kgd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(238020..240719)
Genome map
AA seq 899 aa AA seqDB search
MEKYSFLNALHPKLIEELYQKYIHLPECLDPSWMAFFQGFDFGTAHSISSSVFENNIFKE
FQVISLIEAYRSIGHIFSITNPIISKHTDINLDIEEFGLSSGDQTKVFQAAKLLNKKPCT
LSTILDSLKATYCKSLGIEYLHINSPERIAWIQNRINKNDNHPSISRENKLNLLKKLNET
IVFENYLHTKFAGKKIFSIEGNETLLPAIEELLEYASVTYSVEELVVGMAHRGRINVLAN
IFKKDLSEMFSEFNSNEYEEIGFAGDVKYHLGVTTIRNNSKGKIVRMILSPNPSHLESVN
SVVEGIARANIDHSFCGNYKKLLPILIHGDAAISGQGIIYEIVQMSQLFGYHSGGTIHII
VNNQIGFTTNYTDGRSSSYCTDVAKVILSPVLHINGDDVEAVIHAIHIAVDFRLHFKQDV
FIDLIGYRKYGHNEGDEPNFTQPTLYKRISNHPNAKDIYKKKLDNEQIREINLIQNEDFR
NKLELVYEISHSRECNKIDYFLNDEWINLHRPNPDILFQKIDTSFSIDKLYEIGKKITSL
PKELTFYIKTKKLFNKRIEMIEKGLSIDWGMAELLAYGSLLYEGFEVRLSGEDVERGTFS
HRHAIVKTENKEEKYIPLNHINRKQTFLAIYNSPLSEYGVMGFDYGYALSSPKTLTIWES
QFGDFSNGAQIIIDQYISAAEDKWKMQNGLVIFLPHGYEGQGPDHSSGRIERFLQLCGRD
NMCIINCINPSNFYHALRRQIKWSFRKPLIVFTPKSLLRHPFCICSLEDLAIGCFQPIID
DHNSSSKEVTKLVFCSGKIFYELFERRENIKAHHIALIRLEQLYPINTKSIENILIKYDT
YDKLLWVQEEPANMGAWPYISRTKFDFELIARLESASSSCGSYHNFIRTQEEILDRVFK
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatactcttttctaaatgctttacatccaaaactgattgaagaactttatcaa
aaatatattcatttaccagaatgtctagatcctagttggatggctttttttcagggattt
gattttggaacagcacattctatatcatcttccgtatttgaaaataatatttttaaagaa
tttcaggtaatatcattaattgaagcctatagaagtataggacatattttttctataaca
aaccctattatcagtaagcatactgatattaatcttgacatagaagaatttggtcttagc
tctggagatcagacaaaagtttttcaagcagctaagctacttaacaagaagccttgtaca
ctttctactattttagatagtcttaaagctacttattgtaaatctcttggaatagaatat
ttacacataaactcgccagagcgaatagcttggattcaaaatcgtatcaataaaaatgat
aaccatccttctatatctagagaaaataaactaaacttactgaaaaaacttaatgagaca
atcgtatttgaaaattacttacatacaaaatttgcaggtaaaaaaatcttttcaatagaa
gggaatgaaactttgcttccagcaatagaagaacttttagaatatgcctcagtaacttat
tcagtagaagaattggttgtcggaatggctcatagaggtagaataaacgtcttggctaat
attttcaagaaagatctttcagaaatgtttagtgaattcaatagcaatgaatatgaagaa
attggatttgcaggagatgtaaaatatcatttaggtgttactactataagaaataatagt
aagggaaaaatagtaagaatgatactttcacctaatccttcccatcttgaatctgtaaat
tctgtagtagaaggcatagcaagagcaaatatagatcatagtttttgtggcaactataaa
aaacttttacccattcttattcatggagatgctgctatttcaggacaaggtattatatat
gaaatagtgcaaatgtctcagcttttcggatatcattctggtggaaccatacatattatt
gtaaacaatcagattggctttactactaattataccgatggacgttctagttcttattgt
actgatgtagcaaaagtaatactatcaccagtattacacattaatggtgatgatgtagaa
gccgtaatacatgctattcatatagctgtagattttcgtctgcattttaaacaagatgtt
tttattgacctaataggatatagaaaatatggccataatgaaggagatgagcctaatttt
acacaaccaactctttataagaggatttctaatcatcccaatgcaaaagatatctataaa
aaaaaacttgataatgagcaaattagagaaatcaatctgatacagaatgaagatttcaga
aataaactagaattagtttacgaaatatctcattctagagaatgcaataaaattgattat
tttcttaatgatgagtggataaacttacacagacctaaccctgatattctctttcaaaag
atagatactagcttttctattgacaagctatatgaaataggtaaaaaaattacttctttg
cctaaagagttaacattttatataaaaacaaaaaaactctttaataaaaggatcgaaatg
atagaaaaaggtctatctattgattggggaatggctgaattgctagcttatggaagctta
ctatatgaaggatttgaagtacgattatctggtgaagatgttgagagaggtactttttcg
cataggcatgcaatagtaaagacagaaaataaggaagaaaagtatatacctctaaaccat
ataaatagaaaacaaacttttttagcaatatataattctcctctttctgaatatggtgtt
atgggttttgattatggttatgctttgtcttctcctaaaacgctaacaatctgggagtct
caattcggagattttagcaatggagcacagattattatagatcaatatatttcagctgct
gaagataaatggaaaatgcagaatggcttagtcatatttttacctcacggttatgaagga
caaggaccagaccactcgtctggtcgtatagagcgctttttacagctctgtggtcgtgac
aatatgtgtattattaattgtattaatccatctaatttttatcatgctttgagaagacag
ataaaatggtcttttagaaagcctcttattgtttttacgccaaaaagtttgctaagacat
cctttttgtatctgctctcttgaagatttagcaataggttgttttcaacctatcatagac
gaccataattcttcctcaaaagaagtaactaagcttgttttttgctcaggaaagattttt
tatgaactttttgaaagaagagaaaatattaaggcgcatcatattgcacttattcgttta
gaacaattatatcctattaacacgaaaagtatagaaaatattttgataaaatacgatact
tacgataaattgctatgggttcaagaagagcctgcaaatatgggagcttggccatatatt
tcacgtactaaatttgatttcgaattgatagcgagattagaaagtgcttcttcttcatgt
ggttcttatcataattttataagaacacaggaagaaattttagatagggtatttaaataa

DBGET integrated database retrieval system