KEGG   Ustilago maydis: UMAG_11945Help
Entry
UMAG_11945        CDS       T01021                                 

Definition
(RefSeq) putative hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
uma  Ustilago maydis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:uma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMAG_11945
   00051 Fructose and mannose metabolism
    UMAG_11945
   00052 Galactose metabolism
    UMAG_11945
   00500 Starch and sucrose metabolism
    UMAG_11945
   00520 Amino sugar and nucleotide sugar metabolism
    UMAG_11945
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    UMAG_11945
Enzymes [BR:uma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     UMAG_11945
Membrane trafficking [BR:uma04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    UMAG_11945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
7
AA seq 515 aa AA seqDB search
MSFSSEKGSSRRGSISLASKRRGSGTEKLETHIASWHTSSHKHEENPHAHEEQLKQTYER
FEKLFTITPQRLRMITDRFVGVLEEGLQKDGQTVPMLPAYVFGWPTGDEVGSYLALDLGG
TNLRVCHVVLKGAGKFEITQSKFRLTEEQKQTEGQELFDFCADCLATFIKDHFGDQNGDV
ILEEELALGFTFSYPMEQDKIDHGKLVRWTKGFGNPNTEGRDCAAMFRKSLDKFNLPVKM
VSIINDTTGTLIASNYVNRETRIACIFGTGCNAAYMEHMKDIPKIKHLGLPEEEDMAINC
EYGAFDSFQHEHMAEIRTKYDEHIDLHSNKPHEQSYEKMIAGLYLGEIFRLCICDLIDEG
TLFLGQNTYKLEKTNAFDTAFLSLIESDPTDELLTVTGLFTHFFGIDTTIEERQFFRKLA
KLIGTRSARLSSCGIAALVTKMGYLDKGCGVGADGSLYSKYPGFADRLHQALEDIFGEKG
RNIRTYQAEDGSGVGSAIIAAMTKARKEEGKYADV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctcttccgaaaaaggcagcagccgccgcggctccatctcgcttgccagtaag
cgtcgaggctctggtaccgagaagctcgaaactcatatcgcctcatggcacaccagttcc
cacaagcacgaggaaaacccacatgcgcacgaggaacagctcaagcagacctacgagcgt
ttcgagaagctcttcaccatcacgcctcagcgtctgcgcatgatcaccgatcgtttcgtc
ggagtccttgaggagggtcttcagaaggatggtcagaccgtgcccatgctccctgcctat
gtctttggctggcccaccggtgacgaggtcggctcttacctcgctcttgacctcggtggc
accaacttgcgtgtctgccacgttgttctcaagggcgccggaaagttcgagattacacag
tccaaattccgtctcacagaggagcagaagcagaccgaaggtcaggaactctttgacttt
tgtgccgactgcttggccactttcatcaaggaccactttggcgaccaaaacggcgacgtc
atccttgaagaggagcttgcgctcggattcaccttcagctacccgatggagcaggacaaa
atcgatcatggcaagctcgtccgatggaccaaaggcttcggcaaccccaacaccgaaggc
cgcgactgcgctgccatgttccgcaaatcgcttgacaagttcaatttgcctgtcaagatg
gtctcgatcatcaacgataccaccggaacgctcatcgcctctaactatgtcaaccgcgaa
accaggatcgcctgcatctttggtaccggctgtaacgccgcctacatggagcacatgaag
gacattcccaagatcaagcacctcggcctccccgaggaagaggacatggccatcaactgc
gagtacggcgcctttgactcgtttcagcacgagcacatggccgagatccgaaccaagtac
gacgaacacattgaccttcactcgaacaagccacacgagcagtcgtatgaaaagatgatc
gccggtctctacctgggcgagattttccgactgtgcatctgcgacctgatcgacgagggt
acgctcttcttgggccagaacacgtacaagctggaaaagaccaacgccttcgacacggcc
ttcctgtcgttgattgaatccgaccctacggacgagcttttgactgtgaccggtctgttt
acacacttctttggtatcgacactacgatcgaggagaggcaattcttccgcaagctggcc
aaactcatcggtacacgatcggcgcgtctgagctcgtgcggtatcgctgcgctggtaacc
aagatgggttacctggacaagggatgcggtgtgggtgccgacggttcgctctactctaaa
tatcctggattcgccgaccgcttgcaccaggcgctcgaggatatctttggcgaaaagggg
cgcaacattcgcacctaccaggctgaagacggttcgggtgtaggatcggccatcattgct
gccatgaccaaggcacgcaaggaggagggcaagtacgccgatgtgtaa

DBGET integrated database retrieval system