KEGG   Ursus maritimus (polar bear): 103660837Help
Entry
103660837         CDS       T03271                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04068  FoxO signaling pathway
umr04146  Peroxisome
umr04211  Longevity regulating pathway
umr04213  Longevity regulating pathway - multiple species
umr05016  Huntington's disease
Brite
KEGG Orthology (KO) [BR:umr00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    103660837 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    103660837 (SOD2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    103660837 (SOD2)
   04213 Longevity regulating pathway - multiple species
    103660837 (SOD2)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    103660837 (SOD2)
Enzymes [BR:umr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103660837 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103660837
NCBI-ProteinID: XP_008686725
LinkDB All DBs
Position
Un
AA seq 219 aa AA seqDB search
MNYGCTSRTLVPALGSLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHATYVNNLN
AIEEKYLEALEKGDITAQVALQPGLKFNGGGHINHSIFWTNLSPKGGGEPKGELLEAIKR
DFGSFEKFKEKLTTVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGID
VWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaattatggctgcacgagcaggacgctggtgccggcgctggggtcgctgggttccagg
cagaagcacagcctccccgacttgccgtacgattatggcgccctggagcctcacatcaac
gcccagatcatgcagctgcaccacagcaagcaccacgcgacctacgtgaacaacctgaat
gccatcgaggagaagtatctggaggcgctggagaaaggtgacattacagctcaggtagct
cttcagcctgggctcaagttcaatggcggaggccatatcaatcattccatcttctggaca
aacctgagccctaagggtggtggagaacccaaaggggaattgctggaggccatcaaacgt
gattttggttccttcgaaaaatttaaggagaagttgaccactgtatctgttggcgtccaa
ggctcaggttggggttggcttggtttcaataaggaacagggacgcttgcagattgctgct
tgttctaaccaggatccgctgcaaggaacaacaggtcttattccactactggggatcgat
gtgtgggagcacgcttattaccttcagtataaaaatgtcagaccagattacctaaaagct
atttggaatgtaatcaactgggagaatgtaacggagagatacatggcttgcaaaaagtaa

DBGET integrated database retrieval system