KEGG   Ursus maritimus (polar bear): 103661214Help
Entry
103661214         CDS       T03271                                 

Gene name
PCGF2
Definition
(RefSeq) polycomb group ring finger 2
  KO
K11460  polycomb group RING finger protein 2
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:umr00001]
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    103661214 (PCGF2)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     103661214 (PCGF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_3 zf-rbx1 zf-C3HC4_2 zf-RING_2 Rad60-SLD FAP zf-C3HC4
Motif
Other DBs
NCBI-GeneID: 103661214
NCBI-ProteinID: XP_008687152
LinkDB All DBs
Position
Un
AA seq 326 aa AA seqDB search
MKGALILLSFSTPCPPPPAVCKTCIVRYLETNKYCPMCDVQVHKTRPLLSIRSDKTLQDI
VYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQEKGALSDNEIVSLSIEFY
EGVRDREEKKGPLENGDGDKEKTGVRFLQCPAAMTVMHLAKFLRNKMDVPSKYKVEVLYE
DEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLPTAPTPSEGTNTSGASECES
VSDKAPSPATLPATSSSLPSPATPCHGSPSSHGPPATHPTSPTPPATASGATTAANGGTS
NCLQTPSSTSRGRKMTVNGAPVPPLT
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaagggggctctgattctgctttctttctccaccccctgccccccgccccccgcagtc
tgcaaaacctgcatcgtgcgctacctggagaccaacaagtactgccccatgtgtgacgtg
caggtccataaaaccaggccgctgctgagcatcagatctgacaaaaccctccaagacatc
gtctataaactggtccctgggctttttaaagatgagatgaaacggcggcgggatttctat
gcagcataccccctgaccgaagtccccaacgggtccaatgaggaccgcggcgaggtcctg
gagcaggagaagggagctctgagcgacaacgagattgtcagcctctccatcgagttctac
gaaggtgtcagggaccgggaggaaaagaagggtcctctggagaatggggatggggacaag
gagaagacaggggtgcgattcctgcaatgcccagcagccatgactgtcatgcatctcgcc
aagtttcttcgcaataagatggacgtccccagcaagtacaaggtggaggttctctacgag
gacgaaccgctgaaggaatactacacgctcatggacatcgcctacatctatccgtggcgg
cggaatggccctctccccctcaagtatcgggtccagccggcctgcaagcggctcaccttg
cctacagcacccaccccctcggagggcaccaacaccagcggggcatctgagtgtgagtca
gtcagcgacaaggctcccagccctgccaccctgccggccacctcctcctccctacccagc
ccagccaccccctgccatggctctcccagctcccacgggcccccagccacccaccctacc
tcccccactcctccagcaacagccagtggggccaccacagctgccaacgggggtacctcg
aactgcctgcagacaccatcttccaccagcagggggcgcaagatgactgtcaacggagct
cctgtgccccccttaacttga

DBGET integrated database retrieval system