KEGG   Ursus maritimus (polar bear): 103662840Help
Entry
103662840         CDS       T03271                                 

Gene name
NEU2
Definition
(RefSeq) neuraminidase 2
  KO
K12357  sialidase-2/3/4 [EC:3.2.1.18]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00511  Other glycan degradation
umr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:umr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    103662840 (NEU2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    103662840 (NEU2)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     103662840 (NEU2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNR_2 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-GeneID: 103662840
NCBI-ProteinID: XP_008688770
LinkDB All DBs
Position
Un
AA seq 379 aa AA seqDB search
MASCPVLQKERVFQSGDRAYRIPALLYLPQQKTLLAFAEKRMSKKDEHAELIVLRRGSYD
ASTHRVQWHAQEVVAQAQLEGHRSMNPSPLYDEKTGTLFLFFIAIPGQVSEHHQLHTRVN
VTRLCQVTSTDHGRSWSPARDLTGPAIGAAHKEWATFAVGPGHCLQLHNKTQSLVVPAYA
YRNLHSLQGPSPFAFCFVSHDHGHTWKRGNFVAQDTLECQVAEVGGARQRVVYLNARSPL
RARVQAESTNEGLDFQETQTVRKLVEPPHGCHGSVISFPNPREGSGASDKWLLYTHPTDP
QERADLGVYLNKRLPGPEAWSEPALLATGSCAYSDLQSMGVGPDGSPQFGCLYESDNYEE
VVFLMFTLKQAFPAEFLSQ
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggcatcctgccctgtcctgcagaaggagagggtgttccagtcaggagaccgtgcctac
agaatccccgctctgctctacctgcctcagcagaagactctgctggccttcgcagaaaag
cggatgagcaaaaaggacgagcacgcagagctgattgtactgcgcagaggaagctatgat
gcatccacccaccgtgtccagtggcatgctcaggaggtggtggcccaagcccagctggag
ggccaccggtccatgaacccgagccccttgtacgacgagaaaacgggaaccctcttcctc
ttcttcattgccatccccgggcaggtctccgagcaccaccagctccacaccagggtcaac
gtgacacggctgtgccaggtcaccagcacggaccacgggaggtcctggagcccggccaga
gacctcaccggccctgccatcggcgcagcccacaaggaatgggccacttttgcggtgggt
ccggggcactgtctacagctgcacaacaagacccagagtctggtggtgcccgcctacgct
taccggaaccttcactccctccaggggccttccccatttgccttctgtttcgtcagccat
gaccacgggcacacatggaagagagggaactttgtggcccaggacaccctggagtgccaa
gtggctgaagtagggggtgcgaggcagagggtggtgtatctgaatgctagaagccccctc
agagcccgggtccaggctgagagcaccaacgaggggctcgacttccaggagacccaaaca
gtgaggaagctcgtggagcctccccacggctgccacgggagtgtcatcagttttcccaac
ccccgtgagggctcaggagcctcagacaaatggctgctctacactcacccgactgacccc
caggagagggctgacctgggggtgtacctcaacaagcggctcccaggccccgaggcctgg
tcggagcccgctctgctggccacgggcagctgcgcctactcagacctccagagcatgggc
gtcggccctgatggctcaccccagttcgggtgtctgtatgaatcggataattacgaagag
gtcgtcttcctcatgttcaccctgaaacaagccttcccagctgaatttttgtctcaatga

DBGET integrated database retrieval system