KEGG   Ursus maritimus (polar bear): 103665497Help
Entry
103665497         CDS       T03271                                 

Gene name
B3GALT4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K00715  
ganglioside galactosyltransferase [EC:2.4.1.62]
Organism
umr  Ursus maritimus (polar bear)
Pathway
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:umr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00604 Glycosphingolipid biosynthesis - ganglio series
    103665497 (B3GALT4)
Enzymes [BR:umr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.62  ganglioside galactosyltransferase
     103665497 (B3GALT4)
Glycosyltransferases [BR:umr01003]
 Glycan extension
  Glycolipid
   103665497 (B3GALT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 377 aa AA seqDB search
MPLSLFRRLLLAALLLVIIWTLFGPSGIGEELLSXASLRPAPASPGPPLALPRLLIPNEE
ACRGPGAPPFLLILVCTAPDNLNQRNAIRASWGGLREARGLRVQTLFLLGEPSLWHPTRE
PHGIDLVQEAAAQGDILQAAFRDSYRNLTLKTLSGLNWANKHCSMARYILKTDDDVFVNV
PELVSELIRRGGRWEQWEKGKEPPPREVEAGDEDWEVGSVLRSQPMPLLYLGRVHWRVHP
SRTPGSKHQISEEQWPPTWGPFPPYASGTGYVLSASAVQLILKVASRAPSLPLEDVFVGV
SARRGGLTPTHCVKLAGATHYPLDRCCYGKIKLDPWKMQEAWKLVGGSEGERMAPFCSWL
QEVLGILRCRVIAWLHS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcagcctcttccggcgccttctccttgccgccctgctgctggtgattatctgg
accctcttcgggccttcgggcatcggggaagagcttttgagcnntgcctccctgcgcccg
gctccggcctccccagggccgcccctggccctgccccgcctcctgatccccaatgaagag
gcgtgcaggggtcccggcgccccacccttcctgctcatccttgtgtgcacggccccagac
aacctgaaccaaagaaatgccattcgggcttcgtggggcgggctgcgcgaggcccggggg
ctcagggtgcagactctctttctgctcggagagccaagcttgtggcatcctacgagggag
ccccacggcatcgatctagtgcaggaggcagcagcccagggggacatcttgcaggcggcc
ttccgggactcctaccgtaaccttactctcaagaccctcagcgggctgaactgggcaaac
aaacactgctccatggcccgctacatcctcaagacagacgatgacgtgtttgtcaatgtc
cccgaactggtatcagagctgattcggcgagggggccgttgggaacaatgggagaagggc
aaggagccgcctccaagagaggttgaggctggagatgaagactgggaagtagggtctgtc
ttgaggagccagccaatgcctcttttgtacctgggccgtgtgcactggcgggtgcacccc
tctcggacaccagggagcaagcaccagatatcagaggagcagtggcctcccacctggggc
ccctttccaccctatgcctctggcacagggtacgtgctgtcagcttctgctgtgcagctc
atcctgaaagtggccagccgggcaccctctctgccactggaggatgtctttgtgggggta
agcgcccgacgaggaggcctcaccccaacccactgtgttaagctggctggggccacccac
taccccttggaccggtgctgctatgggaaaattaagctggacccttggaaaatgcaggaa
gcctggaagctggtgggcggctctgaaggagaaaggatggcacccttctgctcctggctt
caggaagttttgggcatccttcggtgtcgggtaatagcctggcttcacagctga

DBGET integrated database retrieval system