KEGG   Ursus maritimus (polar bear): 103669055Help
Entry
103669055         CDS       T03271                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
umr  Ursus maritimus (polar bear)
Pathway
Neuroactive ligand-receptor interaction
Pancreatic secretion
Protein digestion and absorption
Influenza A
Brite
KEGG Orthology (KO) [BR:umr00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103669055
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    103669055
   04974 Protein digestion and absorption
    103669055
 Human Diseases
  Infectious diseases
   05164 Influenza A
    103669055
Enzymes [BR:umr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     103669055
Peptidases [BR:umr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   103669055
Exosome [BR:umr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103669055
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 302 aa AA seqDB search
MRRVDVGEARALSSGSPVVGTLASSRARHQEKTSYGPLPTPRAPQFRVTSPCLEILPGVG
WTSSLCPQVAFSTDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCY
KSRIQVRLGEYNIDVTEGNEQFINSAKVIRHPSYNSWTLDYDIMLIKLSSPAVLNTRVAT
ISLPSACAAAGTQCLISGWGNTLSSGSNYPELLQCLDAPLLSQAQCEASYPGQITSNMVC
AGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNRPGVYTKVCNFVDWIKQTIAA
NS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagttgacgtcggagaggccagagctctgagcagcggctctcctgttgtgggg
acgctggcctccagccgcgccaggcaccaggagaagacatcctatgggcccctcccaacc
ccgcgagccccacaatttcgcgtcaccagcccttgcttagaaatcctcccaggagttggt
tggacttcctctctgtgcccacaagttgctttctccactgacgacgatgacaagatcgtc
ggcggctacacctgcgaggagaattccgtcccctaccaggtgtccctgaactcgggctac
cacttctgcggtggctccctcatcaatgaccagtgggtggtgtccgcggctcactgctac
aagtcccgcatccaagtgaggcttggagagtacaacatcgatgtcacggaggggaatgag
cagttcatcaactcggccaaggtcatccgccaccccagctataacagctggaccctggac
tatgacatcatgcttatcaagctctcctcgcccgcggtcctcaacacgcgggtggccacc
atctctctgccctccgcctgcgcggccgctggcacccagtgcctcatctccggctggggc
aacaccctgagctctggcagcaactaccccgagctgctacagtgtctggacgccccgctt
ctgagtcaggcccagtgcgaagcctcctaccccggccagatcacaagcaacatggtttgc
gccggcttcctcgagggaggcaaggactcctgccagggtgactctggtggccctgtggtg
tgcaatggagagctccagggaatcgtctcctggggctacggctgcgcccagaagaacagg
cccggagtctacaccaaggtgtgcaacttcgtagactggattaagcagaccatagctgcc
aacagctga

DBGET integrated database retrieval system