KEGG   Ursus maritimus (polar bear): 103674507Help
Entry
103674507         CDS       T03271                                 

Gene name
TGM3
Definition
(RefSeq) transglutaminase 3
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
umr  Ursus maritimus (polar bear)
Brite
Enzymes [BR:umr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103674507 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 103674507
NCBI-ProteinID: XP_008701644
LinkDB All DBs
Position
Un
AA seq 755 aa AA seqDB search
MGNRLRSACYAQSRSLKFNVIRPRRLALPQLAPPKSCPCGNVHLSPRHHPLPSRTSGPRF
CLTALELQSVNWQATSNRQAHHTDRFSSRELILRRGQSFSFSFSLNRGLGDGESLGFIVS
TGPYPSESARTKAVFPVSNGTSHGGWSAQLVSKQDNILTISMASPVNAPVGVYTLSAQIS
SRGKDFILKLGTFILLFNPWLPEDGVFMNNHAEREEYVQEDAGIIYVGSTNRIGMVGWNF
GQFEEGILNICLSILDHSLNFRRDPATDVARRSDPKYVGRVLSAMVNGNDENGVLSGNWS
GNYTGGLDPRNWNGSVEILKEWKKSGFRPVRYGQCWVFAGTLNTVLRCFGIPSRVVTNFN
SAHDTDRNLSVDVYYDPYGNPIEKGSDSVWNFHVWNEGWFVRTDLGPSYNGWQVLDATPQ
ERSQGVFQCGPASVAAVREGDVNLDFDMPFVFAEVNADRITWIYDASNNTQKQNASDTHS
IGRYISTKAVGSNSRVDITEKYKYPEGSSQERQVFQKALGKLKPHAAFGATSARPLAGEE
REPSISGKFKVTGLLEVGKEVNMALLLKNLTSDMKTVTVNMTAWTIVYNGTLVHEVWKDS
ITISLDPKEEIQHPVKITYAQYEKYLKADNMIRTTAVCQVSDEAEVLVERDIILDNPNLT
LEVLDQARVQKPVNVQMLFSNPLDEPVXDCVLMVEGSGLLLGSLRIDVPTLRPKERSRVR
FEIFPTRSGTKQLLADFSCNKFPAIKAMLSIDVAE
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggggaataggttacgaagtgcttgctacgctcagtcaaggtctctgaagtttaatgta
attcgtcctagaaggctggctcttccccaactagcgccacccaaaagctgtccttgtggt
aacgtacacctttccccacgccaccatccgttgccttccaggacctcaggtccccgcttc
tgtcttacagctttagaactccagagtgtcaactggcaggcgacctccaaccggcaggca
catcacacagacaggttctccagccgggagctcatcttgcgcagaggccagtccttcagt
ttctcatttagcttgaaccgaggtcttggcgatggagaaagcctgggttttatcgtctcc
acagggccttacccctcagagtcggccaggacaaaggctgtgtttccagtctccaatggg
acaagccatgggggctggagtgcccagctcgtgtccaaacaggacaatattctgaccatc
tccatggccagtcctgtcaacgcacctgtcggagtgtacacactgagtgctcagatctcc
tcccggggcaaagacttcattctgaagcttgggacgttcatactgctcttcaacccctgg
ttgccagaggatggggtctttatgaataaccatgctgagagagaggagtacgtgcaggaa
gacgccggcatcatctacgtggggagcacgaatcgaatcggcatggttggctggaacttt
ggacagttcgaagaaggcattctgaacatttgcctctcgatcctggatcacagcctgaat
ttccgtcgtgaccctgctactgacgtggcccgcagaagtgaccccaaatacgtcggccga
gtgctcagtgcgatggtcaacggcaatgatgaaaacggtgtgctctccgggaattggagt
ggcaactacacgggtggcctggacccacggaactggaacggcagcgtggagatcctcaag
gagtggaaaaaatcgggcttcaggccagtccgatacggccagtgctgggtctttgctggg
accctcaacacagtgctgagatgtttcgggattccctcccgagtggtcaccaacttcaac
tccgctcatgacacagaccggaacctcagtgtggacgtgtactacgacccctatgggaac
cccatagaaaaaggcagtgacagcgtgtggaatttccacgtctggaatgaaggctggttt
gtgcggactgacctgggcccttcgtacaacggatggcaggttctggacgccaccccccag
gagaggagccaaggggtgttccagtgcggccccgcttccgtcgctgcggtccgagagggc
gacgtgaacctggacttcgacatgcccttcgtctttgccgaggtaaacgccgaccgcatc
acctggatctacgatgcctccaacaacacccagaagcagaatgcgtcggacactcacagc
attggaaggtacatcagcaccaaggcggtgggcagcaactctcgcgtggacatcacggag
aagtacaagtatccagaaggttccagccaggagagacaagtgtttcaaaaggctttgggg
aaacttaaaccccacgcggcctttggcgccacgtctgcaagacccctggcaggagaggaa
agggagcccagcatctcggggaagttcaaggtcactggcctattggaggtgggcaaagaa
gtcaacatggccctcttgctcaaaaacctgacgagcgacatgaagacagttactgtgaac
atgaccgcctggaccatcgtctacaacggcacgctggtacacgaggtgtggaaggactcc
atcacaatatccctggatcccaaagaagaaatacagcaccctgtgaagatcacatacgct
cagtatgagaagtacctgaaggccgataacatgatccggaccacggctgtgtgccaggtg
tctgacgaggccgaggtgttggtagaaagggacatcatcctggacaaccccaacctgacc
ctggaggtgctggaccaggcccgggtgcagaagcccgtgaacgtccagatgctcttctcg
aacccactggacgagccggtgtaagactgcgtgctgatggtggagggcagcggcctgctg
ctgggcagcctccggattgacgtgccaactctgcgccccaaggagcggtcccgggtgcgt
tttgagatctttcccacccggagtggaaccaagcagctgctcgccgacttctcctgcaac
aagttccctgcaatcaaggccatgctgtccatcgacgtggctgagtga

DBGET integrated database retrieval system