KEGG   Ursus maritimus (polar bear): 103676246Help
Entry
103676246         CDS       T03271                                 

Definition
(RefSeq) glutamate decarboxylase 1-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00250  Alanine, aspartate and glutamate metabolism
umr00410  beta-Alanine metabolism
umr00430  Taurine and hypotaurine metabolism
umr00650  Butanoate metabolism
umr01100  Metabolic pathways
umr04727  GABAergic synapse
umr04940  Type I diabetes mellitus
Module
umr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:umr00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    103676246
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    103676246
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103676246
   00430 Taurine and hypotaurine metabolism
    103676246
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    103676246
 Human Diseases
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    103676246
Enzymes [BR:umr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     103676246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase SepSecS
Motif
Other DBs
NCBI-GeneID: 103676246
NCBI-ProteinID: XP_008703633
LinkDB All DBs
Position
Un
AA seq 617 aa AA seqDB search
MRNHGFVKVQREAFKEALQVIKPSLSKQVGDLQKKLMVTPDTVHLKIEERTNGNIFSYTF
IVMPEPYNCPVKEEITPFQTAETPKDKEEMRKSSGHTFQSTEKNVIKGAQTETVTTNLSN
AYASDLLPSKDSKDLTKCFLLQVVNILLNYIKKTFDVKSKILDFHHPHQLLEGLDGLDLE
LSDHPESLEQLLVDCTDTLKYGVKTGHPRFFNQLSSGLDVIGLAGEWLTATANTNMFTYE
IAPVFTVMETILLKKMYEIIGWRETEADGIFAPGGSISNLYGILVARYKQYPEIKRQGMT
ALPCIVLFVSEQGHYSVKKAAAILGIGTDNVIEVKCDERGKMIPAELEKNILQAKTKGQT
PFCVTATAGTTVFGAFDPLHAIADICETHRLWMHVDAAWGGGLLLSRNHAHKLSGIERAN
SVTWNPHKLMGVPLQCSAILIREKGLLEACNQMRAGYLFQPDKPYNVDFDTGDKTIQCGR
HVDIFKLWLMWKAKGTRGFEAQINRYMELATYFYKILKKKDNFKLVFDAEPEFTNVCFWY
FPPRLKRIPKGFERDQELQKIAPKIKAQMVEEGTAMISFQPCGDKVNFFRMVFSNPATRQ
ADVDYLIDEIERLGKDL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatcatggctttgtgaaagttcaaagagaagctttcaaggaggccctgcaagtc
atcaagccaagcttatcaaagcaggtaggcgacctgcaaaagaaactaatggttacacct
gacactgtgcacctaaagatagaggagcgaacgaatggcaacattttttcctacactttc
attgtcatgcccgagccttacaattgcccagtgaaggaggaaatcaccccatttcagacc
gcagagaccccaaaagataaggaagagatgagaaaaagttctggtcatacttttcagtca
actgagaaaaatgtgataaaaggtgctcagactgagactgtaacgactaatttatcaaac
gcttatgcttcagatttgttgccatccaaggatagtaaagatttaacaaaatgttttttg
ctacaagtggtaaatattcttctgaattacatcaaaaaaacttttgatgttaagagtaaa
atactggactttcatcatcctcatcaacttcttgaaggtttggatgggttagacttagaa
ctgtctgaccaccctgaatctttggagcaattacttgttgactgcacagataccttaaaa
tatggtgttaaaacaggacaccctcgcttttttaaccagctctccagtggcctagatgtc
atcggactcgctggggaatggttgaccgccactgccaataccaacatgtttacctatgaa
atagctccagtatttactgtcatggaaacaattcttcttaagaaaatgtatgaaattatt
ggctggcgagaaacagaagcagatggaatatttgcacctggtggaagtatatccaacctc
tatggtatattagtagcccgttataagcaatatccagagataaaaagacaaggcatgacc
gcactcccgtgcatcgtgttatttgtttctgaacaaggtcattattcagtaaaaaaagct
gcagcaatccttggtattggaactgacaatgtaattgaagtaaaatgtgatgaaagggga
aagatgattccagctgagttagagaaaaacatattacaagctaaaacaaagggccagact
cctttctgtgtcacagccacagccggcaccacagtgttcggggccttcgaccctctccac
gccatcgccgatatttgtgagacacacagactctggatgcacgtggacgcagcctgggga
ggtggattgctgctgtccagaaaccacgcccataaactcagtggcattgagagggcgaac
tctgtgacctggaatccacataaactcatgggtgtcccccttcagtgctctgccatcctg
atccgggaaaaaggtcttctggaagcatgtaaccagatgcgagctggatatcttttccag
ccagataaaccctacaatgtggactttgacactggggataaaactattcagtgtggccga
catgttgatatctttaagctctggttaatgtggaaagcaaagggaacccgtggctttgag
gcacagatcaacagatatatggaacttgcaacatacttctataagattttgaagaaaaaa
gataactttaagcttgtgtttgatgcagagcctgagttcaccaatgtctgcttctggtat
tttccaccaagacttaaacgtatcccaaaaggttttgaaagagatcaggaactccaaaag
attgctccgaagattaaagcacagatggtggaggaaggcacagccatgataagcttccag
ccatgtggggacaaagtaaatttttttcgaatggttttttctaaccctgccacaagacaa
gcagatgttgattatcttattgatgaaattgaaaggcttggaaaggatttatga

DBGET integrated database retrieval system