KEGG   Ursus maritimus (polar bear): 103680190Help
Entry
103680190         CDS       T03271                                 

Gene name
HDAC8
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr05034  Alcoholism
umr05165  Human papillomavirus infection
umr05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:umr00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    103680190 (HDAC8)
  Substance dependence
   05034 Alcoholism
    103680190 (HDAC8)
  Infectious diseases
   05165 Human papillomavirus infection
    103680190 (HDAC8)
Enzymes [BR:umr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103680190 (HDAC8)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     103680190 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 103680190
NCBI-ProteinID: XP_008707944
LinkDB All DBs
Position
Un
AA seq 351 aa AA seqDB search
MCDSLAKVPKRASMVHSLIEAYALHKQMRIVKPKVASMEEMATFHTDAYLQHLQKVSQEG
DDDHPDSVEYGLGYDCPATEGIFDYAAAVGGATITAAQCLIDGVCKVAINWSGGWHHAKK
DEASGFCYLNDAVLGILRLRRKFDRILYVDLDLHHGDGVEDAFSFTSKVMTVSLHKFSPG
FFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKYYHICESVLKEVYIAFNPKAVVLQLGA
DTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLVLGGGGYNLANTARCWTYLTGVILGKT
LSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPHRVQQILNYIKGNLKHVV
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgactccctggccaaagtccccaaacgggccagtatggtacattctttgatcgaa
gcgtatgcactgcataagcaaatgaggatagttaagcccaaagtagcgtccatggaggag
atggccaccttccacactgatgcatatctgcagcatctccagaaggtcagccaagaagga
gatgacgatcacccagactccgtagaatatgggctaggttatgactgcccagccacggaa
gggatatttgactacgcagcagctgtaggaggggccacgatcacagctgcccagtgcctg
attgacggagtgtgcaaagtagcaattaactggtccggagggtggcatcatgcaaagaaa
gatgaagcatctggtttttgttatctcaatgatgctgtcctgggaatattacgattgcgg
cggaaatttgaccgtattctctatgtggatttggatctgcaccatggagatggtgtagaa
gatgccttcagtttcacctccaaagtcatgacagtgtccctgcacaaattctccccggga
tttttcccaggaacaggtgacgtgtctgatgttggcctagggaagggacggtactacagt
gtaaatgtgcccattcaggacggcatacaggatgagaagtattaccacatctgtgaaagt
gtactaaaggaggtatacatagcctttaatcccaaagcagtggtcttacagctgggagct
gatacgattgctggggatcccatgtgctcctttaacatgactccagtgggaattggcaaa
tgtcttaagtacatccttcagtggcaattggcaacactcgttttgggaggaggaggctat
aaccttgccaacacggctcgatgctggacatacttgaccggggtcatcctagggaaaaca
ctatcctctgagatcccagatcatgagtttttcacagcatatggtcctgattatgtgttg
gaaatcacgccaagctgccggccagaccgcaatgagccccaccgagtccagcaaatcctc
aactacatcaaagggaatctgaagcatgtggtctag

DBGET integrated database retrieval system