KEGG   Ursus maritimus (polar bear): 103680304Help
Entry
103680304         CDS       T03271                                 

Gene name
KMT5C, SUV420H2
Definition
(RefSeq) lysine methyltransferase 5C
  KO
K11429  histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
umr  Ursus maritimus (polar bear)
Pathway
umr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:umr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103680304 (KMT5C)
Enzymes [BR:umr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103680304 (KMT5C)
Chromosome and associated proteins [BR:umr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103680304 (KMT5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 103680304
NCBI-ProteinID: XP_008708072
LinkDB All DBs
Position
Un
AA seq 347 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQHHLRSALEAFLRQRD
LEAAYRALTLGGWMAHYFQSRGPRQEAALKTHIYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECYTCERKGEG
AFRLRAMNLLKLLRIQVSGDPAIRLHSHLRPQPAAQKICEICEKCGQLRRPWLAMQQSQE
CHPGREPRSWAHVSPGGTHGLTRCLQELQAPVDGLAIPELLIEEGSG
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggacctgacagagtaacagccagagagctgtgtgagaatgacgaccttgccaccagc
ctcgtcctggacccctacctcggcttccgcacccataagatgaacgtcagccccgtgccc
cccctgcggcgacagcaccacctgcgctcagcgctggaggccttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggatggcccactacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacatctatcgctacctccgagccttc
ctgcccgaaagcggctttactatcctgccctgtacacgctattccatggagacaaatgga
gccaagattgtgtctaccagagcttggaagaagaacgagaagctggaactgctggtgggc
tgcatcgcagagctgcgggaggccgacgaggggctgctgagggccggcgagaacgacttt
agcatcatgtactccacccgaaagcgcagtgcgcagctgtggctgggccccgccgccttc
ataaaccatgactgcaaacccaactgcaagtttgtgcccgcagatgggaacgcggcctgc
gtgaaggtgctccgggacattgagcccggggatgaggtgacctgcttctacggggagggc
ttctttggtgagaagaatgagcactgtgaatgctacacgtgtgagaggaaaggcgaggga
gccttccgcctgcgggccatgaaccttctcaagctgctcaggatccaggtcagtggagac
cctgccatccgtcttcattctcacctccgcccccagccagcggcccagaagatatgcgag
atatgcgagaaatgcggacagctaaggagaccatggctggcaatgcagcagagccaagag
tgccatccaggccgggaacccaggtcctgggcccatgtgtctcctgggggcacacatggc
ttgaccagatgcctccaggagctccaggcccctgttgatgggctggccatcccggagctg
ctgatcgaggagggcagtgggtga

DBGET integrated database retrieval system