KEGG   Uncinocarpus reesii: UREG_05116Help
Entry
UREG_05116        CDS       T01132                                 

Definition
(RefSeq) similar to fatty acid oxygenase
  KO
K17863  linoleate 8R-lipoxygenase / 9,12-octadecadienoate 8-hydroperoxide 8R-isomerase [EC:1.13.11.60 5.4.4.5]
Organism
ure  Uncinocarpus reesii
Pathway
ure00591  Linoleic acid metabolism
Brite
KEGG Orthology (KO) [BR:ure00001]
 Metabolism
  Lipid metabolism
   00591 Linoleic acid metabolism
    UREG_05116
Enzymes [BR:ure01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.60  linoleate 8R-lipoxygenase
     UREG_05116
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.5  9,12-octadecadienoate 8-hydroperoxide 8R-isomerase
     UREG_05116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase p450
Motif
Other DBs
NCBI-GeneID: 8439237
NCBI-ProteinID: XP_002584427
UniProt: C4JRM7
LinkDB All DBs
AA seq 1091 aa AA seqDB search
MGQDSTSRRSVLDDFGKYFSQLSGIANGALRPIAPDSGYPSPSMDSTPGILQDLGELDVK
DVGTVLELVKNMASGAPVDDKRYIMERVIQLASSLPTGSRNGTALTNSLLGQLWNDLPHP
PVSYLGRQFIYRQADGSYNNIYWPQVGMAGSTYARSVQPKLVQPVSRPDPGLLFDGLLAR
RKFREHQTKLSSMLFYLAALIIHDLSPLYGCNQEEQDQVRTFRDGKLKPDCFSERRVAGF
PPGVGVLLVMFNRFHNHVVQNLAAINENNRFRKPDTNDKEAYAKYDNDLFQTGRLITCGL
YVNIILKDYVRTILNVNRTDSDWSLDPRSDFREFLSHKPVAEGGGNMVAAEFNLVYRWHS
CLSDRDDRWMQDVFREVFDGRDPSSASTMEFLRGVSKWESSLPDDPMLRTFAKLKRTSNG
SYNDDELVEILIESIEDCAGTFGARHVPKVLRPVEIMGILQSRSWNLSTLNEFRKYFNLT
PHKTFEDINSDPEVAEQLRHFYGHPDNVEIYPGIVVEEAKVPLVPGSGLCASFTISRTVL
SDAVALVRGDRFYTVDYTPQNLTNWGYTEAGPDMAVNHGHLFHKLIFRAFPSHFRPDSVY
AHFPFVVPTENEKILNDLGIVDKYSWARPGPMPHPTMIHSYSACKSILNNKLDFKVTWGD
KIKFLMRRSQIPYGANFMLSGDEFVHEESRQMMKKALYIDDWHKQVGDFYERITLKLLHA
KSHRISEVNQVDIVRDVANLAQVHFCSNVFLLPLKTEENPHGIFTETELYSILALVFSCI
FYDADPAQSFKLREMSRSATQKLGQLVMLNVQVISKTGFIGGIIDRLQANEALADYGIHM
IRRLLETKLPADELVWTHILPTAGGMVANQGQLFSQCLDYYLSPEGSSHLPEIRRLAHLN
TKEADDLLLRYFLEGARMRSTVALFRDVATNVTVQDHDKEQSLQTGQRILCNLVSACKDP
EAFPEPDKVDLTRDLDSYIHLGLGPHECLGAGMTKVALTTMLKVVGKLENLRRAPGPQGQ
LKKIPGPGGITAYMSEDESRLSPFPTTMKVLWDAFECKFRSEYQFPQSESRKLISNSTAV
RRIESPRRWGV
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atgggacaggactcgacttctcgccgaagcgtacttgacgactttggaaaatacttctct
cagcttagcggaatcgccaatggtgctctgcgcccgatagctcctgactctgggtacccc
tcgccgagcatggattctaccccggggattctccaggacttgggagaactggatgtcaaa
gatgtaggaacggtgcttgagctagttaagaatatggctagtggtgcgccagtggacgat
aaaaggtatattatggaaagggttatccagctggcctcatcgttacctactggatctcgg
aacggcactgcactcacgaattctctgctaggtcaactttggaatgacttgcctcacccg
ccggtatcatatttgggccggcagtttatttatcgacaagctgatggatcctacaataac
atctattggcctcaagtcggaatggcaggatccacctatgccagaagcgtgcagccgaaa
ttggttcaacctgtttcacgtccggacccgggtttattatttgatggcctcctagccaga
cggaaatttagggagcaccaaaccaagctgtcgagtatgctcttctatctagcagctctg
atcattcatgatctgtctccattgtacgggtgcaatcaggaagagcaagatcaagtcaga
accttcagagatgggaagcttaagcccgattgcttctccgagagacgagtagctggtttc
cctcctggtgttggtgttttacttgttatgtttaatcggtttcacaaccatgttgttcag
aacctcgcggctatcaacgaaaataaccgctttcgaaaaccggatactaatgacaaggaa
gcgtatgcgaagtatgataacgaccttttccagacggggcgtttaattacctgcgggctc
tatgtgaacatcattttgaaagactacgttcgaaccatcctcaatgtcaaccgaacggac
agcgactggagccttgaccctagatcagactttagggagtttctaagccacaagcctgtt
gcagaagggggcggcaacatggttgcggctgaattcaatcttgtctatcggtggcactct
tgcctctcagacagggatgaccgctggatgcaagacgtgttcagggaggttttcgacggc
agggacccaagttctgccagcacgatggagtttctacgaggtgtttcaaagtgggagagc
tctcttcccgacgaccctatgctccgaacttttgcaaaacttaagcggacatccaatgga
agttataatgacgacgaattggttgaaatcttaatagaaagcatcgaggactgtgctggg
acttttggggcgaggcatgtccccaaggttcttcgacctgtggaaatcatgggtattctt
caatctcgatcgtggaacctatctaccctcaacgaattccggaagtatttcaatctcacg
ccgcataaaacatttgaagatatcaattcagatcccgaggttgcagaacagttgagacac
ttttatggccatccagataacgttgagatataccctgggattgtcgttgaggaagcaaag
gttcctttggtgcccggaagtgggctctgtgctagcttcactatatcccgaacggttctt
tccgacgctgttgctctcgtgagaggagatcgattctataccgttgactataccccacaa
aaccttacaaactggggttataccgaagcaggccccgatatggcggtcaatcacggccac
ctattccataaactcatattccgtgcgttccctagtcattttaggccggactcggtctat
gcgcatttcccatttgtcgtgcctaccgagaacgaaaagattctaaatgacttgggtatc
gttgataaatattcctgggccaggccgggccctatgccccatccaacaatgatacattct
tacagcgcttgcaagtcgattttgaacaacaagctggatttcaaagtcacctggggcgat
aagattaaatttttgatgagacgtagtcagatcccgtacggagctaactttatgttgtcc
ggagacgaattcgtgcacgaggaatcccgtcagatgatgaagaaggctctatatatcgac
gactggcacaagcaggtcggggacttttatgaacgaatcaccctgaaactgttgcatgca
aaatcacatcgaatttcagaagttaaccaggttgacattgttcgtgatgtcgcaaatcta
gcgcaggttcacttctgttcaaatgtgtttttactgccgctgaaaacagaggaaaatccg
catggcattttcacagagactgagctctactcgatattagcccttgtcttcagttgcata
ttctatgacgccgacccggcccaaagcttcaagcttcgggagatgtctaggagtgccacc
cagaaactgggacaacttgtgatgttgaatgtccaggtcatttcgaaaactggtttcatc
gggggtattatcgacagattacaagccaatgaggcattggcggactatggaatccacatg
atacggcgtctcctggaaacaaagctgccagctgacgaacttgtctggacgcatattctc
cccacagccgggggcatggttgcgaaccaaggccagcttttctcgcaatgtcttgattac
tacctatcaccggagggctcaagccacttgccagagatacgcagattggctcatttgaac
acgaaggaagccgatgatcttcttctaagatacttcttggaaggagctcgaatgcgatcc
actgtagccttgttccgggacgttgctaccaatgtcacggtccaagaccacgataaagag
caaagcttgcagactggacaacgaatactctgtaacttggtatctgcatgcaaggaccca
gaggctttccccgagcccgacaaggtcgatctcacccgcgatcttgattcgtatatccac
ctcggattagggcctcatgagtgcttgggggcagggatgactaaagtggcactgacaact
atgctaaaggttgtgggtaagcttgaaaatcttcgtcgtgcgccgggacctcaaggacaa
cttaagaagatccctggacccggcggaatcacagcgtacatgtctgaagacgagagtcgg
ctgtctccattcccgaccacgatgaaggtattgtgggacgcttttgaatgcaagtttcgt
agtgaatatcaatttccccagagtgaatcccgcaagttgatctcaaattcaacggcggtc
cggaggatagaaagtccgcgccgatggggcgtgtaa

DBGET integrated database retrieval system