KEGG   Variovorax sp. PAMC 28711: AX767_20525Help
Entry
AX767_20525       CDS       T04325                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
vaa  Variovorax sp. PAMC 28711
Pathway
vaa00250  Alanine, aspartate and glutamate metabolism
vaa00410  beta-Alanine metabolism
vaa00430  Taurine and hypotaurine metabolism
vaa00650  Butanoate metabolism
vaa01100  Metabolic pathways
vaa01110  Biosynthesis of secondary metabolites
vaa01120  Microbial metabolism in diverse environments
vaa02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vaa00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    AX767_20525
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AX767_20525
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AX767_20525
   00430 Taurine and hypotaurine metabolism
    AX767_20525
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    AX767_20525
Enzymes [BR:vaa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AX767_20525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMM26469
UniProt: A0A126ZH58
LinkDB All DBs
Position
complement(4255636..4257018)
Genome map
AA seq 460 aa AA seqDB search
MPIHHVDLDDQSSLRDIYATKASQDSLPKYRLPQGRTEPRAAYALVRDELLLDGNARQNL
ATFCTTWIEDEVKHLMADAIDKNMIDKDEYPQTAELESRCVHILADLWHAQQSRETVGCS
TTGSSEAAMLGGLAFKWKWRKRREAEGKDFSKPNIVTGPVQICWHKFARYFDVEIREVPL
EGDALGLRPEDLRGHCDENTIGVVATLGVTFTGVYEPVEALARELDAMQRDLGLDIPIHV
DAASGGFIAPFIQRDLVWDFQIDRVRSINASGHKYGLAPLGVGWVIWASKKDLAEELIFN
VDYLGGNMPTFALNFSRPGGQIIAQYYNFLRLGWDGYTAVQQACSDTAQWLSAELAKLEP
FEMVYDGHGGLPAVAYRLTDADHGFTLYDLSERVRMRGWQIASYPLPANRKDTVVQRILI
RHGVSRDLAQLLLDDIKRALRDLTKNPVPNSTAKPGFHHG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcatcacgtcgacctcgacgaccaatccagcctgcgcgatatctatgcgacc
aaggcttcgcaggacagccttcccaaataccgactgccccaagggcgcaccgagcctcgc
gccgcctacgccttggtgcgtgacgagttgctgctcgacggcaatgcccgtcagaacctc
gcgaccttttgcacgacctggatagaggacgaggtcaagcacctgatggcggatgcgatc
gacaagaacatgatcgacaaggacgagtatccgcagacggccgagctcgaaagccgatgt
gtccacatccttgccgacctctggcatgcccagcaatcgcgagagacagtgggctgctcg
acgaccggttccagcgaagcggccatgctcggcggcctcgcattcaaatggaagtggcgc
aagcgtcgggaagcggaaggcaaggatttcagcaagcccaacatcgtgaccggcccggtg
cagatctgttggcacaagttcgcccggtatttcgatgtcgagatccgcgaggtaccgctc
gagggtgatgcgctcggtctcaggcccgaagacctgcgcggccactgcgacgaaaacacc
atcggcgtcgtcgcgacgctgggcgtcaccttcacaggcgtttacgagcccgtcgaggcc
ttggcgcgcgaactcgatgccatgcagcgcgacctcgggctcgacatcccgatccatgtg
gatgccgcctctggcggattcatcgcgccgttcatccagcgcgacctcgtctgggacttt
cagatcgaccgggtccggtcgatcaacgcctctgggcacaagtacggccttgcgccgctc
ggcgtgggctgggtcatctgggcatcgaagaaagacctggccgaagagctgatcttcaac
gtcgattacctgggcggcaacatgccgacctttgcgctgaacttctcgcgcccgggtggc
cagatcatcgcgcagtactacaactttctgcgcctcgggtgggacggctacacggccgtt
cagcaagcctgttccgatacggcgcagtggttgagcgccgaactggccaagctcgagccg
ttcgagatggtctacgacggccacggcggactgcccgcggttgcctatcggctgaccgat
gccgaccacggcttcaccctttacgacttgtccgagagggtgcggatgcggggctggcag
atcgcgtcgtatccgcttcctgcgaaccgcaaggacaccgtggtccaacgcatcctgatc
cgccacggcgtcagccgcgatctcgcgcagcttcttctcgacgacatcaagcgcgcgctt
cgtgacctgacgaagaatccagtcccgaactccactgcgaaacctggattccaccatggg
tga

DBGET integrated database retrieval system