KEGG   Vibrio alginolyticus: N646_3233Help
Entry
N646_3233         CDS       T02840                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  
superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
vag  Vibrio alginolyticus
Brite
Enzymes [BR:vag01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     N646_3233
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
2:176466..176981
Genome map
AA seq 171 aa AA seqDB search
MLKGLLCISVASALVAAPNALAKTVEMTALNTNESAGTIEISQSDYGVVFTPQLSGLSAG
VHGFHVHTNPSCDSIEKDDKTVLGGAAGGHYDPNNTGKHGYPWTNDNHLGDLPPLYVDMD
GNANQPVVAPRLKLSDLKGRALMIHAGGDNHSDHPSKLGGGGARVVCGVIE
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaggattgctatgcatttcagttgcatccgctcttgtcgccgcccctaacgcg
ctagcaaaaacggtagaaatgactgctctcaacaccaatgagagcgcgggtaccattgag
atttcacaaagtgattatggcgttgtttttacgcctcaattatcaggtttgtcagcaggt
gtgcacggtttccatgttcacactaatccatcttgcgatagcatagaaaaggatgacaaa
accgtattaggcggcgcagcaggtggccattatgatcctaacaacacagggaagcatggc
tatccttggaccaatgacaatcatttaggcgacttgcctccactctatgtggacatggac
ggcaatgccaatcagcccgttgtcgcgcctcgcctaaaattatcggatttaaaaggtcga
gcgttaatgatccatgcaggtggtgacaatcactccgatcacccaagtaagctaggtggt
ggcggcgctcgcgtcgtatgtggtgttattgaataa

DBGET integrated database retrieval system