KEGG   Verticillium alfalfae: VDBG_07692Help
Entry
VDBG_07692        CDS       T02227                                 

Definition
(RefSeq) trypsin
  KO
K01312  
trypsin [EC:3.4.21.4]
Organism
val  Verticillium alfalfae
Brite
Enzymes [BR:val01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     VDBG_07692
Peptidases [BR:val01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   VDBG_07692
Exosome [BR:val04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VDBG_07692
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 256 aa AA seqDB search
MVFKTLVAALGFAAVAFGSPVPAPQEELQIVGGVAASAGDFPFIVSLQRSGSHFCGGSLL
NANTVLTAAHCSTGVSASSVTVRAGSLNRSSGGTLVRVSSIVVNPGYVASRYDNDFAIWK
LATPIPTSSTISYATLAAANSDPAANTLTTTAGWGTTSSGGSTLPTALRKVDVPIISRAT
CRSYYGTSAVTTNMICAGFAAGGKDSCQGDSGGPIIEASSRTLVGVVSWGEGCAAPNAPG
VYARVGAARTFINQYL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggtttttaagactctcgtcgccgctcttggcttcgccgccgtcgccttcggctcgccc
gtccctgccccccaggaggagcttcagatcgttggcggcgttgctgccagcgctggagac
ttccccttcatcgtctccctgcagaggagcggttcccacttctgcggcggatctcttctg
aacgccaacaccgttctgaccgctgctcactgcagcaccggcgtcagcgcttcctccgtg
actgtccgcgccggcagcctgaaccgcagctccggtggcactcttgtccgtgtttcctcg
atcgtcgttaaccccggctacgttgcctcgaggtacgacaacgacttcgccatctggaag
ctcgctactcccatccccacgagctccaccatcagctacgccaccctggccgccgccaac
tcggaccccgccgccaacactctcaccaccaccgctggctggggaaccacctcgtccggc
ggcagcaccctccccaccgccctgaggaaggttgatgtccccatcatctcccgcgccacc
tgccgctcctactacggcacctctgccgtcaccacgaacatgatctgcgccggcttcgct
gccggtggcaaggactcctgccagggtgactccggcggccccatcatcgaggccagctcc
aggactctcgtcggtgttgtctcttggggtgagggctgcgctgctcccaacgctcccggt
gtttacgcccgcgttggcgccgcccgcaccttcatcaaccagtacctttaa

DBGET integrated database retrieval system