KEGG   Vibrio anguillarum 775: VAA_04277Help
Entry
VAA_04277         CDS       T01536                                 

Definition
(GenBank) Protein Translation Elongation Factor Tu (EF-TU)
  KO
K02358  
elongation factor Tu
Organism
van  Vibrio anguillarum 775
Brite
Translation factors [BR:van03012]
 Eukaryotic Type
  Elongation factors
   VAA_04277
 Prokaryotic Type
   VAA_04277
Mitochondrial biogenesis [BR:van03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    VAA_04277
Exosome [BR:van04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   VAA_04277
  Exosomal proteins of breast cancer cells
   VAA_04277
  Exosomal proteins of colorectal cancer cells
   VAA_04277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
I:complement(3055625..3056857)
Genome map
AA seq 410 aa AA seqDB search
MRGHQSHLNPYLEGQLMSKAKFERTKPHVNVGTIGHVDHGKTTLTAAICTTLAKVYGGEA
KDFASIDNAPEERERGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGGIL
VVAATDGPMPQTREHILLGRQVGIPYIIVFMNKCDMVDDEELLELVEMEVRELLSEYDFP
GDDLPVIQGSALGALNGEEQWEAKIIELAEALDTYIPEPERAVDQAFLLPIEDVFSIQGR
GTVVTGRIERGILRVGDEVAIIGIKDTITTTCTGVEMFRKLLDEGRAGENVGALLRGTKR
DEVERGQVLAKPGSITPHTKFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTGDISL
PEGVEMVMPGDNIQMVVELIAPIAMDEGLRFAIREGGRTVGAGVVAKVIA
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
ttgcgtggtcatcaaagccacctaaatccgtacctagagggacaactcatgtctaaagca
aaatttgaacgtacgaaaccgcacgtaaacgttggtactatcggccacgttgaccacggt
aaaacaactctaactgctgctatctgtactacacttgcaaaagtgtacggtggtgaagcg
aaagacttcgcatctatcgataacgctccagaagagcgcgagcgcggtattacaatcaat
acttctcacgtagagtacgatacaccagcacgccactacgcacacgtagactgcccagga
cacgctgactatgttaaaaacatgatcacaggtgctgcgcaaatggacggcggtatccta
gttgttgctgcaacagatggcccaatgccacaaactcgtgagcacatcctacttggtcgc
caagttggtattccttacatcatcgtattcatgaacaaatgtgacatggttgatgatgaa
gagcttctagagctagtagaaatggaagttcgtgagcttctatctgagtacgatttccca
ggtgatgacctaccagttatccaaggttctgcactaggcgcactaaacggcgaagagcag
tgggaagcgaaaatcattgaacttgctgaagcgctagacacttacattccagagcctgag
cgtgcagtagaccaagcattcctactaccaatcgaagacgtattctcaatccaaggtcgt
ggtacagtagtaactggccgtatcgagcgcggtatcctacgtgtaggtgacgaagttgcg
attattggtatcaaagacacaatcacaacgacttgtacaggtgttgagatgttccgtaag
ctgcttgacgaaggtcgtgcaggtgagaacgttggtgcacttctacgtggtactaagcgt
gatgaagtagaacgtggtcaagtactagcgaaaccaggttcaatcactccacacactaag
ttcgagtcagaagtgtacgtactgtctaaagatgaaggcggccgtcatactccgttcttc
aaaggctaccgtccacagttctacttccgtacaacggacgtaacaggcgatatctctcta
ccagaaggtgtagagatggtaatgccaggtgacaacatccaaatggttgtagagctaatc
gctccaatcgcgatggatgaaggtctacgtttcgcgatccgtgaaggtggtcgtacagta
ggtgctggtgttgttgctaaagttatcgcttaa

DBGET integrated database retrieval system