KEGG   Variovorax paradoxus S110: Vapar_0581Help
Entry
Vapar_0581        CDS       T00916                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
vap  Variovorax paradoxus S110
Brite
Translation factors [BR:vap03012]
 Eukaryotic Type
  Elongation factors
   Vapar_0581
 Prokaryotic Type
   Vapar_0581
Mitochondrial biogenesis [BR:vap03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Vapar_0581
Exosome [BR:vap04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Vapar_0581
  Exosomal proteins of breast cancer cells
   Vapar_0581
  Exosomal proteins of colorectal cancer cells
   Vapar_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:635768..636961
Genome map
AA seq 397 aa AA seqDB search
MAKGKFTRTKPHVNVGTIGHVDHGKTTLTAAIATVLSAKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVGYIIVFLNKCDMVDDAELLELVEMEVRELLDKYEFPGDDTPIIHGSAKLALE
GDKGKLGEEAIMKLAEALDTYIPTPERAVDGTFLMPVEDVFSISGRGTVVTGAVERGVIK
VGEEIEIVGIRPTVKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREEVERGQVLCKPGS
IKPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGAIELPKDKEMVMPGDNVS
ITVKLINPIAMEEGLRFAIREGGRTVGSGVVAKILDI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaggtaaattcacccgcaccaagccgcacgtgaacgtgggcacgatcggtcac
gttgaccacggcaagaccacgctgacggcggccatcgccacggtgctgtcggccaagttc
ggcggcgaagccaaggcctacgaccagatcgacgcggcgcccgaagaaaaggcccgcggc
atcaccatcaacaccgcccacgtcgagtacgagacggccaaccgccactacgcgcacgtc
gactgccccggccacgccgactacgtcaagaacatgatcaccggcgcggcccagatggac
ggcgccatcctcgtgtgctcggccgccgacggccccatgccccagacccgcgagcacatc
ctgctggcgcgccaggtgggtgtgggctacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgccgaactgctcgagctcgtcgaaatggaagtgcgcgaactgctcgacaag
tacgagttcccgggcgacgacacccccatcatccacggctcggccaagctcgccctggaa
ggcgacaagggcaagctcggtgaagaagccatcatgaagctggccgaagccctcgacacc
tacatcccgacgcccgagcgcgccgtggacggcaccttcctgatgcccgtggaagacgtg
ttctcgatctccggccgcggcaccgtcgtgaccggcgccgtcgagcgcggtgtcatcaag
gtcggcgaggaaatcgagatcgtcggcatccgcccgaccgtcaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccaaggccaggcgggcgacaacgtcggcgtgctg
ctgcgcggcaccaagcgcgaagaagtcgagcgcggccaggtgctgtgcaagcccggctcg
atcaagccgcacacgcacttcaccgccgaggtgtacgtgctgtccaaggacgaaggtggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgcacgacggacgtg
accggcgcgatcgagctgcccaaggacaaggaaatggtcatgcctggcgacaacgtcagc
atcaccgtgaagctgatcaacccgatcgcgatggaagaaggcctgcgcttcgccatccgc
gaaggcggccgcaccgtgggttcgggcgtcgtggcaaagatcctcgacatctaa

DBGET integrated database retrieval system