KEGG   Variovorax paradoxus S110: Vapar_1684Help
Entry
Vapar_1684        CDS       T00916                                 

Definition
(GenBank) glutathione S-transferase-like protein
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
vap  Variovorax paradoxus S110
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:vap00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Vapar_1684
Enzymes [BR:vap01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Vapar_1684
Transporters [BR:vap02000]
 Other Transporters
  Pores ion channels [TC:1]
   Vapar_1684
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:1816570..1817226
Genome map
AA seq 218 aa AA seqDB search
MAKPVLTISSKNYGAWALRGWLMCRLAGLDFSEKIIPPDDPAMKAEMLLLSSSMLVPSLQ
HGGVKVWDTLAIGEYLNEIKPKSGLLPVDIQARAHCRAICGEMHSGFASMRGALPMNIKA
RFRGFKIWSRAQADIDRIVAIWRECLKTYGGPFLFGKQPGIADAMYAPVVTRFLSYDVPL
DSVCAAYCKRVMDLPAMQEWVAAAKEEPEEIDELDAEF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggccaaacccgttctcacgatcagcagcaagaactacggcgcctgggcgctgcgcggc
tggctgatgtgcaggctggccgggctcgacttcagcgagaagatcatcccgcccgacgac
ccggccatgaaggccgagatgctgctgctctcgtcgtcgatgctggtgccctcgctgcag
cacggcggcgtcaaggtgtgggacacgctggccatcggcgaatacctgaacgagatcaag
cccaagagcgggctgctgccggtcgacatccaggcgcgcgcgcattgccgcgccatctgc
ggcgagatgcattcgggctttgcctcgatgcgcggcgccttgccgatgaacatcaaggcc
cggttccgcggcttcaagatctggtcgcgcgcgcaggccgacatcgaccgcatcgtcgcc
atctggcgcgaatgcctcaagacctacggcggcccctttctcttcggcaagcagcccggc
atagccgacgccatgtatgcgccggtggtcacgcgcttcctgagctacgacgtgccgctc
gacagcgtttgcgccgcctactgcaagcgtgtgatggacctgcccgccatgcaggagtgg
gtggccgccgcgaaggaagagcccgaggaaatcgacgagctcgacgccgagttctag

DBGET integrated database retrieval system