KEGG   Variovorax paradoxus S110: Vapar_2645Help
Entry
Vapar_2645        CDS       T00916                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
vap  Variovorax paradoxus S110
Brite
Enzymes [BR:vap01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Vapar_2645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ACS19270
JGI: Vapar_2645
UniProt: C5CKW6
LinkDB All DBs
Position
1:2788587..2789168
Genome map
AA seq 193 aa AA seqDB search
MEHVLPPLPYALDALAPEYSKETLEYHYGKHHNAYVVNLNNLQKGTEFESMPLEDIVKKS
SGGIYNNAAQIWNHTFFWSCMKPQGGGAPTGALAKAIDAKWGNYDAFKEAFVKSAVGNFG
SGWTWLVKKADGSVDIVNMGAAGTPLTTGDTPVLTVDVWEHAYYIDYRNLRPKFVETFLA
KLVNWDFAAKNFG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggaacatgtgctcccacccctgccatacgcccttgacgcgctggcacccgagtactcg
aaggagaccctcgagtaccactacggcaagcaccacaatgcctacgtggtgaacctcaac
aacctgcaaaagggcaccgagttcgagtcgatgcctctcgaggacatcgtcaagaagtcc
agcggcggcatctacaacaacgccgcccagatctggaaccacaccttcttctggagctgc
atgaagccccagggcggcggtgcccccacgggcgcgctggccaaggccatcgatgccaag
tggggcaactacgacgccttcaaggaagccttcgtgaagtcggccgtgggcaacttcggc
tcgggctggacctggctggtgaagaaggccgacggctcggtggacatcgtgaacatgggt
gccgcgggcacgccgctgaccaccggcgacaccccggtgctgacggtggacgtctgggag
cacgcctactacatcgactaccgcaacctgcgccccaagttcgtcgagaccttcctggcc
aagctggtgaactgggacttcgcggccaagaacttcggctga

DBGET integrated database retrieval system