KEGG   Variovorax paradoxus S110: Vapar_3746Help
Entry
Vapar_3746        CDS       T00916                                 

Definition
(GenBank) amino acid adenylation domain protein
Organism
vap  Variovorax paradoxus S110
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
LinkDB All DBs
Position
1:complement(3961048..3966378)
Genome map
AA seq 1776 aa AA seqDB search
MEKNTQAQQAPISPRPTNFVAHLRALADARRDDIWLTVVSAVDGTERAEPISYGTFERRV
RALAARLQQQFAKKGERALVMLDNGDHYAVSMLACFYAGVIAVPVFPPESARPQHLARLT
GIAADSQARCVLTSEAMARAMNAASAGLRQFGDAHIVAVDTVDISLADAWTPFEPADGDV
AFLQYTSGSTSAPKGVIVTHGNLMANEEAIQRSMGVGPGDSFVSWAPLYHDMGLIGGLLQ
PLYSGIPLVLTSPGYFLERPVRWLELISRHRATLSGGPDFAYRLCLERVKDAQLAPLDLS
SWRVAYTGAEPVRADTEIEFISRFASAGFDAAAVYPCYGLAEATLFVTGGRRGGGLVAPT
FSATGLASGVGAPADEGAALVGCGNVAPGHRIEIVDAESLSAAAPGKIGEIWTCGPSIGH
GYWGKERETRETFVERNGQRWLRTGDLGFMHEGQLYVTGRIKDLIIVRGHNIYPQDIERL
IEAEVDAVRKGRVAVFATQGPGGEGIGVAAEVSRSMQKLVPAAVLVDALGAAVSEVFGET
LSVVLLLNPGGMPKTTSGKLQRSACRAGWLDGSADAYAVYQHGAFVRGGLGEAVAEAPLD
EVEQAVAAIWREVCKHGDDRPLGRDAHFFNRGGSSLTATQAAARIGARWQIDFPARRLFE
QPRLRDCASAIRELQLQGVRPQPAPIAVLSAERRLLPLPLSHAQERQWFLWQIDPESAAY
HVSGALRLAGALRVDALQAAFDGLVARHESLRTVFSAGADGSVEQWIRPGGSVPLALVDL
RGAEAEADARLDEATRRLKAQPFDLTQDPLLRAALIRTADEVHVLAVVMHHIVSDGASMQ
LLIDELAAGYAAHLKGDTVRLAAPRIQYADHALWQREWLAAGEGERQLAWWRTQLGDTHT
VLELRTDHPRKPQAGYGAASHAFELPASLLARLRKAADGGGATLFMVLLAGFQALLHRYT
GQEDIRIGAPFANRNRVEAEGVVGLFVNTLVLRNPIHGRLGASRVLAQARDAVLGAQAHQ
DVPFEQLVQMLQPERSLSRTPLFQVMFNHLFEDYRSLGQLPGIAAQDHALPDLAAQFELT
LEARERPGGQLSLALIYAAELFEPGTMARMASHYVAVLQALVERPHQPIGDIELLGAPEQ
AQLAQWGVNGHREPQPEPVHRMIERQARMQPDATALLFADESLGFAELNRRANRLAHRLI
ALGVKPEVLVGIAMERSVEMVVAILGVLKAGGAYVPLDPEYPAERLAYMVQDSGIGLLLT
QRSVAYCVANCVPDRRALTVLEVDAADLGAEPESDPQVGLHIENLAYVIYTSGSTGKPKG
AAIRHSALHSCMAWMQGIYKLTRADTVLHKAPFGFDVSVWELFWPMTSGARLVVANPGDH
RDPARLVELIQRHQVTTLNFVPSMLQAFLAHKGIEASTRLRHIICGGEAMPAETQKETLE
RLHGAGLQNLYGPTETTIHVTHWACRNDGQSQVPIGKPISHTSAHVLDAELNLVPQGVAG
ELYLGGISLARGYLKRAGLSAERFVADPFDSAGGGRLYRTGDLVRWNGEGQLEYLGRIDH
QVKIRGFRIELGEIEAELLAQPAVREAVVVARDGPAGARLVGYLAPHAGEAIDTAALKER
LAQVLPDYMVPRAFEVLDALPLNANGKVDRKALPEPALASGQAYEAPQGHVAQTVAAVWS
EVLQVAQVGLHDNFFDLGGHSLLLIRAHRLLEDRLHTAIPVVNLFKYPTVQSLVQWLEQA
PARAAASASAAAASDDRALRQRAAMLQRRKAAERVN
NT seq 5331 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaacacacaggcgcagcaggcgccgatctcgccgcgcccaacgaatttcgtg
gcacaccttcgcgcgctggccgacgcgcggcgcgacgacatctggctcaccgtcgtgagc
gcggtggatggcacggagcgcgcggagccgatcagctacggcaccttcgagcgccgcgtg
cgcgcgcttgcggcccggctgcagcagcagttcgccaaaaaaggcgaacgcgccctcgtc
atgctggacaacggcgaccactatgcggtgagcatgctggcctgcttctacgcgggcgtg
attgcggtgccggtgttcccgccggaatcggcgcgcccgcagcacctcgcacggctgacc
ggcattgccgccgattcgcaggcgcgctgcgtgctgacttccgaggccatggcgcgcgcg
atgaatgcagcgagcgcgggcctgcgccagttcggcgatgcgcacatcgttgcggtcgat
accgtggacatctcgctcgccgatgcgtggacgcccttcgagccggcggatggcgacgtc
gccttcctgcaatacacctcgggctccacctcggcgcccaagggcgtgatcgtgacgcac
ggcaacctgatggccaacgaggaggcgatccaacgcagcatgggtgtcggcccgggcgac
agcttcgtttcgtgggcgccgctctatcacgacatgggcctgatcggcggattgctgcag
ccgctctacagcggcattccgctggtgctcacgtcgccgggctacttcctggagcgcccg
gtgcgctggctcgaactgatctcgcgccatcgcgcgacgctcagcggcggccccgacttt
gcctaccgcctgtgcctggaacgggtgaaggatgcgcaactggccccgctcgacctgtcg
agctggcgcgtggcctacaccggcgccgaacccgtgcgcgccgacaccgaaatcgaattc
atctcgcgcttcgcatcggcgggtttcgatgcggcagccgtctatccctgctacggcctc
gccgaagcgacgctcttcgtcaccggcggccgccggggcggcggcctggtcgcgcccacg
ttttccgccaccggcctcgccagcggggtgggagcgcctgcggacgagggcgcggcgctg
gtcggctgcggcaacgtcgcgcccggccatcgcatcgagatcgtcgatgccgaatcgctc
tcggccgcagcccccggaaagatcggcgagatctggacctgcggcccgagcatcggccac
ggctactggggcaaggagcgcgaaacccgcgagaccttcgtcgagcggaacggccagcgc
tggctgcgcaccggcgacctcggcttcatgcacgaaggccagctctacgtcaccggccgc
atcaaggacctgatcatcgtccgcggccacaacatctacccgcaggacatcgagcggctc
atcgaggccgaggtcgatgcggtgcgcaagggccgcgtcgcggtcttcgccacgcagggg
ccgggcggcgaaggcatcggcgtggccgccgaggtgtcgcgcagcatgcagaagctggtg
ccggccgcggtgctggtcgatgcgctgggcgccgccgtgagcgaggtgttcggcgagacg
ctgtcggttgtgctgctgctcaaccccggcggcatgcccaagaccaccagcggcaaactg
cagcgcagtgcctgccgcgcgggctggctcgacggcagtgccgatgcctatgccgtctac
cagcacggcgccttcgtgcgcggaggcctgggcgaagccgttgccgaggcaccgctcgac
gaagtcgagcaggccgtcgccgccatctggcgcgaggtctgcaaacacggcgacgaccgc
ccgcttggccgcgatgcccacttcttcaaccgcggcggcagctccctcaccgccacgcag
gcggccgcgcgcatcggcgcgcgctggcagatcgactttcccgcacgcaggctcttcgag
cagccgcgccttcgcgactgcgcatcggccatccgcgaactgcagctgcagggcgtgcgc
ccgcagcccgcgccaatcgccgtgctctccgcggagcggcggctgttgccattgccgctc
tcgcacgcgcaggagcgccagtggttcctctggcagatcgatcccgagagcgcggcctac
cacgtgagcggcgcgctgcgcctggccggcgcgttgcgggtcgatgccctgcaagcagcg
ttcgacggtctggtggcgcgccacgaatcgctgcgcacggtcttcagcgccggtgccgat
ggcagcgtggagcaatggatcaggccgggcggctccgtgccgctggcgctggtcgacctg
cgcggcgccgaagccgaagccgatgcccgattggacgaagccacgcggcgcctcaaggcc
cagcccttcgacctcacgcaggatccgctgctgcgcgccgcgctgatccgcaccgccgac
gaggtgcatgtgctcgccgtggtgatgcatcacatcgtgtccgatggcgcctcgatgcag
ctgctgatcgacgaactggccgcgggctacgccgcgcacctgaagggcgacaccgtgcgc
ctggccgcgccgcgcatccagtacgccgaccatgcgctctggcagcgcgagtggctggcg
gcgggcgagggcgagcggcaactggcctggtggcgcacgcagctcggcgacacgcacacc
gtgctcgagctgcgcaccgaccacccgcgcaagccgcaagccggctacggcgctgcgagc
catgccttcgagcttccggcgagccttctcgcgcggctgcgaaaggccgcggacggcggt
ggcgccacgctcttcatggtgctcctggccggcttccaggcgctgctgcaccgctacacg
ggccaggaagacatccgcatcggcgcaccgtttgccaaccgcaaccgcgtggaagccgaa
ggcgtggtcggcctgttcgtcaacacgctggtgctgcgcaacccgatccatggccgcctc
ggtgcatcgcgggtgctggcgcaggcgcgtgacgcggtgctgggcgcacaggcgcaccag
gatgtgcccttcgagcaactcgtgcagatgctgcagcccgagcgcagcctgagccgcacg
ccgctgttccaggtgatgttcaaccacctgttcgaggactaccgctcgctcggacagctg
cccggcatcgccgcgcaagaccatgcgctgcccgatctcgcggcgcagttcgagctcacg
ctcgaagcgcgcgagcggccgggcggccagctctcgctcgccctgatctacgcggccgag
ctgttcgagcccggcaccatggcgcgcatggccagccactatgtcgcggtcctgcaggcg
ctggtcgagcgtccccatcaacccatcggcgacatcgagctgctcggcgcgccggagcag
gcccaactcgcgcagtggggtgtgaatgggcaccgcgagccgcagcccgagccggtgcac
cgcatgatcgagcggcaggcccgcatgcagcccgatgccactgcgctgctgttcgccgac
gagtcgcttggctttgcggaactgaaccgccgcgccaaccgcctggcgcaccggctgatc
gcgctgggcgtgaagcccgaggtgctcgtgggcatcgcgatggagcgctccgtcgagatg
gtggtcgccatcctgggcgtgctgaaggcgggcggcgcctatgtgccgctggaccccgaa
taccccgccgagcgcctggcctacatggtgcaggacagcggcatcggcctgctgctcacg
cagcgcagcgtggcctattgcgtggccaactgcgtgcccgaccgccgcgcgctcacggtg
cttgaagtcgatgccgccgatctcggcgccgagcccgagagcgatccgcaggtcggcctg
cacatcgagaacctcgcctacgtgatctacacatcgggctcgaccggcaagcccaagggc
gcggccatccgccacagcgcgctgcacagctgcatggcgtggatgcagggcatctacaag
ctcacgcgcgccgacaccgtgctgcacaaggcgcccttcggcttcgacgtgtcggtgtgg
gagctgttctggccgatgacctcgggcgcgcggctggtggtggccaaccccggcgatcac
cgcgacccggcgcgcctggtcgagctgatccagcgccaccaggtcaccacgctcaatttc
gtgccctcgatgctgcaggcctttctcgcgcacaagggcatcgaggccagcacgcgcctg
cgccacatcatctgcggcggcgaggcgatgccggccgagacgcagaaggaaacgctcgag
cgcctgcacggcgcgggcctgcagaacctctacggccccaccgagaccaccatccacgtc
acgcactgggcctgccgcaacgatggccagagccaggtgcccatcggcaagccgatcagc
cacaccagcgcccatgtgctggatgccgagctcaacctcgtgccgcagggcgtggcgggc
gagctgtacctgggcggcatcagcctcgcgcgcggctacctgaagcgcgccggcctgagc
gccgagcgcttcgtggccgatccgttcgacagcgctggcggcgggcggctctaccgcacc
ggcgacctcgtgcgctggaacggcgaaggacagctggagtacctgggccgcatcgaccac
caggtgaagatccggggctttcgcatcgagcttggcgagatcgaggccgagctgctggcg
cagcccgccgtgcgcgaagccgtcgtggtcgccagggacggcccggccggcgcgcggctc
gtcggctacctcgcgccgcatgcgggcgaggccatcgacaccgcggcgctgaaagagcgg
cttgcgcaggtgctgcccgactacatggtcccgcgcgccttcgaggtgctcgatgcactg
ccgctgaacgccaacggcaaggtggaccgtaaggcgctgcccgagccggcccttgccagc
ggccaggcgtacgaggcgccgcagggccatgtcgcgcagacggtggctgcggtgtggtcc
gaggtgctgcaggtcgcgcaggttggcctgcacgacaacttcttcgacctgggcggccac
tcgctgctgctgatccgcgcgcaccggctgctggaagaccggctgcacaccgccatcccg
gtggtcaatctcttcaagtaccccaccgtccaatcgctggtccagtggctggagcaggcg
cccgcgcgcgccgccgcatcggccagcgcggccgcggcgagcgacgaccgggcgctgcgc
cagcgcgccgccatgcttcaacgccgcaaagcggcagagagagtcaactga

DBGET integrated database retrieval system