KEGG   Vigna angularis (adzuki bean): 108322143Help
Entry
108322143         CDS       T04660                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain, chloroplastic-like
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
var  Vigna angularis (adzuki bean)
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Photorespiration
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    108322143
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    108322143
Enzymes [BR:var01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     108322143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 163 aa AA seqDB search
MSAETFSAQVAGAAFVGLKSNSSSLCQSTASITWKRKIASNSSKTYCMKTWNPINNKKFE
TLSYLPPLSDESIAKEVDYMIKKGWIPCLEFDEVXRHMPGYYDGRYWTLWKLPMFGCSDS
SEVLKEIHECREAYPNAYIRCLAFDNKRHMQSMAFIIHKPSTT
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgaaactttttcagctcaggttgctggggctgcctttgttggcttgaagtcc
aactcatcaagtctttgccaaagtacagcatctataacatggaaaaggaagattgcttcc
aactcttctaagacttactgcatgaagacatggaatcccatcaacaacaagaagttcgaa
acactgtcctacctgccacctctttcagatgaatccattgcaaaggaggttgactacatg
atcaaaaagggatggattccttgccttgaatttgatgaggttnacaggcatatgccagga
tactatgatgggaggtattggacattgtggaagcttccaatgtttggttgcagtgattct
agtgaagttctgaaggagatccatgaatgcagagaggcatatccaaatgcgtatatacgt
tgcttagcatttgacaacaagcgtcacatgcagtctatggcttttatcatacacaaacct
tctaccacttga

DBGET integrated database retrieval system