KEGG   Vigna angularis (adzuki bean): 108323449Help
Entry
108323449         CDS       T04660                                 

Definition
(RefSeq) histone-lysine N-methyltransferase family member SUVH9-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    108323449
Enzymes [BR:var01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     108323449
Chromosome and associated proteins [BR:var03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     108323449
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 108323449
NCBI-ProteinID: XP_017411404
UniProt: A0A0L9TN75
LinkDB All DBs
Position
1
AA seq 695 aa AA seqDB search
MDSSLSFHTPTNNAISQPEQPPPPPPPPPPPNSHSPPALLVPKPEPFWASDHDDIGDELD
LFTEFNRVTELFHLAFGPTNVVLPPYSFGPQPASPTCSDPLPAADVHSAVQEHPNSLSST
SDASRAIVPVEDLTVSVAPPRKQSRQKELVRVMGLSVREQAQLRETVRRTRLVYDSVRVY
TAVEEERRVAALAAAAAAREAAREAEIKEEQEEEKVVEGRTRRLRGDLRAAGLMRERGLW
LNREKRIVGAIPGILVGDLFLFRMELCVLGLHGQIQAGIDYLPASMSSSGEPIATSVIVS
GGYEDDSDKGEHIFYTGHGGQGKNSSKQVADQKLESGNLALERSMHYGVEVRVIRGMRYE
GSASASGKVYVYDGVYKITQCLFDKGRSGFGVYKFRLSRVEGQAKMGSAILKEARSIRRN
EMESNTVRCLSADMSNKKENVPVRLFNDIDDDRDPLNYEYLARTSFPQFVFHQSGNVTGC
DCVNGCGDGCFCAMKNGGDFPYTLQGHLVKGKPLIFECGPFCSCPSQCRNRVSQKGLKYR
LEVFRSLQTSWGVRSLDLIQAGTFICEFSGVVLTREQAQLFAMNGDSSIYPNRFSERWAE
WGDLSQVDPKYVRPSYPSIPPLDFSLDVSTMRNVACYMSHSSSPNVLVQFVLYDHNNLMF
PHLMLFAMENIPPMRELSLDYGVADEWTGKLSICN
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggattcctctctctctttccacactccaactaacaatgccatctcacaaccggaacaa
ccgccgcctccaccgcctccgccgccgcctcctaactcacattcgccacccgcactctta
gttcccaaacccgaacccttctgggcctctgaccatgacgatatcggagacgaactcgac
ctattcactgagttcaaccgagttaccgagttgttccaccttgccttcggacccaccaat
gtcgtccttcccccctactccttcggacctcaacctgcttcacccacatgctccgacccc
cttcctgctgcggatgtccattcggcggttcaggaacacccgaattcgttgtcctccacc
agcgacgcctcgagagcgatcgtccccgtggaggacctcacggtgagcgttgcgccgccg
cggaagcagagccggcagaaggagctggttcgggtaatgggtctgtcggtgagggaacag
gcacagctgcgggagacggtgaggcgcacgcgcttggtgtacgactcggtgcgcgtgtat
accgctgtggaggaggagaggcgggtggctgccttggcggctgcggcagcggcgagggag
gcggcaagggaggcggagatcaaggaggagcaggaagaggagaaagtggtggagggccgg
actcgacgtctccgcggggacctgcgagctgctggactgatgcgggagcgtggactgtgg
ctgaaccgggagaagcgaatcgttggggcgatccctgggattttggtgggggatttgttc
cttttcaggatggagttgtgtgtgcttgggttgcacggtcagatacaggctggcattgat
tatcttcctgcaagtatgagctccagtggggagcctatagccaccagtgtgattgtttct
gggggttacgaggatgattctgataagggtgagcatatattctacactggtcatggaggg
caggggaagaattcgtctaagcaggttgctgatcagaagttggagtcagggaaccttgca
ttggaaaggagtatgcattacggtgtggaggtgagggttattcgtgggatgaggtatgag
gggagtgcttctgcttctggtaaggtgtatgtgtatgatggagtgtataagattactcag
tgcttgtttgataaggggaggtctggttttggggtttacaagtttaggctttccagggtt
gaggggcaggctaagatgggaagtgctattttgaaggaagctaggagtattaggaggaat
gaaatggaatcgaatactgttcgttgtctttctgctgatatgtccaacaagaaggagaat
gttcctgttcgactttttaacgacatagatgatgatcgagatcctcttaactatgagtat
cttgccaggacaagttttccacagtttgtgtttcatcagagtgggaatgttactggttgt
gactgtgtgaatggttgtggtgatggatgcttttgtgctatgaaaaatgggggtgatttt
ccttacactctgcagggacatcttgtgaaagggaagcctttgatttttgaatgtggccct
ttttgttcttgtccttctcagtgtcgtaatcgtgtttcgcagaagggactgaaatataga
ttggaagtgtttaggtccctgcagacatcttggggtgttaggtctctggaccttattcaa
gccggtacttttatatgcgagttttctggggttgttttgactagggagcaggcgcaactc
tttgcaatgaatggtgactcttcgatatatcccaataggttttcagaaagatgggcggaa
tggggggatttgtctcaagtagatccaaaatatgtgcgtccatcatatccatctattcct
cctttagatttttctctggatgtgtcgactatgaggaatgttgcttgttatatgagccat
agttcatctccaaatgttttggttcagtttgttctgtatgatcacaacaatttgatgttc
ccacaccttatgctatttgcaatggagaatatccctcccatgagagagctcagccttgat
tacggcgtagctgatgagtggacagggaagctctctatatgtaactga

DBGET integrated database retrieval system