KEGG   Vigna angularis (adzuki bean): 108334217Help
Entry
108334217         CDS       T04660                                 

Definition
(RefSeq) beta-galactosidase 8
  KO
K12309  beta-galactosidase [EC:3.2.1.23]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00052  Galactose metabolism
var00511  Other glycan degradation
var00531  Glycosaminoglycan degradation
var00600  Sphingolipid metabolism
var00604  Glycosphingolipid biosynthesis - ganglio series
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    108334217
  Lipid metabolism
   00600 Sphingolipid metabolism
    108334217
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    108334217
   00604 Glycosphingolipid biosynthesis - ganglio series
    108334217
   00511 Other glycan degradation
    108334217
Enzymes [BR:var01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     108334217
Exosome [BR:var04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108334217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_35 Glyco_hydro_42 BetaGal_dom4_5
Motif
Other DBs
NCBI-GeneID: 108334217
NCBI-ProteinID: XP_017425426
UniProt: A0A0L9UNV7
LinkDB All DBs
Position
5
AA seq 705 aa AA seqDB search
MRIRSSKSNGAASKLVAMAKKGSSRATIFFIFVSFILFCAFLPVFAPLPSFHSPHRSHRN
TVNRKFEIASDRFWRDGEPFQIIGGDLHYFRVHPEYWEDRLLKAKALGLNTIQTYVPWNL
HEPAPEKFVFEGFANIEAFLKLCHKLGLLVMIRPGPYICAEWDWGGFPGWFHSINPTPKP
RSSDPTYLQLVERWWGNLLPKFVPLLYDNGGPIIMVQIENEFGSYGDDKAYLHHLVILAR
DHLGHDVILYTTDGGVRENLEKGSIRGDAVFSAVDFSTGDDPWPIFNLQKEFNAPGKSPP
LSAEFYTGWLTHWGEKIATTGADFTAAALEKILQKNGSAVLYMAHGGTNFGFYNGANTGV
DEADYKPDLTSYDYDAPIRESGDVDNSKFNAIRRVIARYSSVPLPSVPSNNEKARYGPIH
LQRKAFLLDTFDFTNSTNVFESETPMPMEYVGQLFGFVLYITEYRAKRGGRILFIPKLHD
RAQVFISCPSEDGARPTYVGTIERWLNNKLNLPDVKCHSNINLFILVENMGRVNYGAYIF
DRKGILSSVYLDGEKAKGWKMFPIPLHNLNEMSTYNPITQASYSAFSEIKSSRKKLTYKH
ENTSKEPAFYSGHFSIDKSSQVMDTFISFSNWGKGIVFVNDFNIGRYWPSRGPQCNLYVP
APILKQGDNFLVILELESPDPELVVHTVSEPDFTCGSNGMSLHQL
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgagaattcgatcgagtaagagtaacggtgcagcatcgaaattggtggccatggcgaag
aagggaagctccagagctaccattttcttcatcttcgtctctttcatacttttttgtgct
tttctccctgttttcgctcctcttccttctttccattctcctcaccgttctcatcgcaat
acagttaacagaaagtttgagatcgccagtgataggttctggagagacggtgaaccgttt
cagatcatcggtggtgatttgcattattttcgagtgcatccggagtactgggaagataga
ctgttaaaagccaaggcattgggcttgaacacaattcagacttatgttccgtggaatctg
cacgagccagctcctgaaaagtttgtttttgagggttttgccaacattgaagcattcctg
aaactttgtcacaaactcggtctccttgtgatgattcgaccaggaccatacatttgtgca
gagtgggattggggtggtttcccaggttggttccattccataaacccaactcccaaacca
agatcatctgatcctacttatcttcaactggttgaaagatggtggggtaatctgcttcca
aagtttgttcctctcctatatgacaatggaggccctataataatggttcagattgaaaat
gagtttggttcttatggagatgacaaagcatatctccatcacttggtcatcctggctaga
gatcatcttggccatgatgttattttatacactacagatggaggcgtgagggaaaatctt
gagaaaggatctattcgtggggatgctgtcttttcagctgttgatttcagtactggtgat
gatccttggcctatattcaacttacaaaaggagttcaatgctccaggaaaatcaccacct
ttgtcagccgagttttacactgggtggcttacacactggggagagaagattgccacgaca
ggagctgattttacagcagctgctcttgaaaaaattttgcaaaaaaatggttctgcagtc
ctctatatggcacatggtgggactaactttggattttataatggagccaatactggtgta
gatgaggctgactacaaacctgatctcacttcttatgattacgatgcaccaattagggaa
tctggtgacgttgacaattcaaaattcaatgctattcgaagggttatagccagatatagc
tcagtacctcttccatctgttccctctaataatgaaaaggcaagatatggaccaattcac
ttacaaagaaaggcttttttacttgacacgtttgatttcaccaattccactaatgtgttt
gaatctgaaactccaatgccaatggagtacgtgggccagttgtttggttttgtattgtat
atcactgaatacagagcgaagagaggtggaagaattttgttcataccaaagttacatgac
agagctcaagtatttatttcatgcccttctgaagatggtgctaggccaacttatgttgga
actatcgaaaggtggttaaataacaaactaaatctccctgatgttaaatgccattctaac
atcaacttatttattctggttgaaaacatgggtcgtgtaaattatggggcttacatcttt
gatagaaagggcattctgtcttcagtttatctggacggggaaaaagcaaaagggtggaaa
atgtttcctattcccttgcacaacctgaatgaaatgtcaacctacaatcctatcacgcag
gcttcctactctgcattcagtgaaataaaatcatccagaaaaaagttgacttataagcat
gagaatacttccaaagaacctgcattttattctgggcacttctcaattgataaatcaagt
caggtcatggatacgtttatatcattcagcaattgggggaaaggcattgtgtttgttaat
gacttcaatataggaagatattggccgtcgagaggaccacaatgcaatctctacgttcct
gctccaatcctaaagcaaggagacaactttttggtaatacttgagctggagtctccagat
cctgaacttgtggtacacacagtcagtgagccagacttcacatgtggctctaatgggatg
agccttcatcagctttaa

DBGET integrated database retrieval system