KEGG   Vigna angularis (adzuki bean): 108340470Help
Entry
108340470         CDS       T04660                                 

Definition
(RefSeq) histone deacetylase 9
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
var  Vigna angularis (adzuki bean)
Brite
Enzymes [BR:var01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     108340470
Chromosome [BR:var03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     108340470
   HDAC complexes
    Sin3A-HDAC complex
     108340470
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    108340470
  Chromatin remodeling factors
   NuRD complex
    108340470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
8
AA seq 429 aa AA seqDB search
MRSKDRIAYFYDGDVGSVYFGAKHPMKPHRLCMTHHLVLSYDLHKKMEIYRPHKAYPVEL
AQFHSADYVEFLHRITPDTQHLFLNELTKYNLGEDCPVFDNLFEFCQIYAGGTIDAARRL
NNQLCDIAINWAGGLHHAKKCEASGFCYINDLVLGILELLKYHARVLYIDIDVHHGDGVE
EAFYFTDRVMTVSFHKYGDLFFPGTGDAKEIGEREGKFYAINVPLKDGIDDLSFTRLFKT
IISKVVETYQPGAIVLQCGADSLAGDRLGCFNLSIDGHSECVSFVKRFNLPLLVTGGGGY
TKENVARCWTVETGVLLDTELPNEIPENDYIKYFAPEFSLKIPNGQIENLNSKSYLSTIK
MQVLENLRCIQHAPSVQMQEVPPDFYIPDFDEDEQNPDERIDQHTQDKHIQRDDEYYEAD
NDNDQMDVS
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccaaggacagaatcgcttacttctatgacggcgatgttggtagtgtttacttt
ggtgcaaagcatccaatgaagccacaccggctttgcatgactcatcatcttgttctctca
tatgaccttcataagaaaatggagatttatcgtccacataaggcttatcctgttgagctt
gcccagtttcactcggctgattatgttgagtttttgcacaggattacgcctgacactcaa
cacttgttcttaaatgaactgacgaaatataatcttggagaagactgccctgtatttgac
aacttgtttgaattttgtcagatttatgctggcggaactatagatgctgctcgtcgattg
aacaaccaactttgtgatatcgctataaactgggctggtggacttcaccatgcaaagaaa
tgcgaggcatctgggttttgttacatcaatgacttggttttaggaatcttggagcttctt
aaatatcatgcccgtgttttgtatattgatatagatgtgcaccatggtgatggcgtagaa
gaagccttctacttcactgatagggtgatgactgtcagttttcataagtatggagacctg
ttcttcccgggtactggtgatgctaaggaaataggagaaagagaaggaaagttttatgcg
ataaatgtcccactgaaggatggaatagatgaccttagcttcacacgacttttcaagact
attatttccaaagtagttgaaacatatcaacctggtgcaatagttctccagtgtggagca
gattcgcttgctggagatcgcttgggttgcttcaatctctctattgatggtcactccgaa
tgtgttagctttgtaaaaagattcaatttgccattgctggtcactggaggtggaggatac
acaaaagaaaatgttgctcgatgttggactgttgaaacaggagttcttctggatacagag
cttcctaatgagattccggaaaatgattatattaaatattttgcaccagaattctctttg
aagattccaaatgggcagatagaaaacctaaatagtaaatcatatcttagcactattaaa
atgcaagtcttggaaaatcttcgttgcatccaacatgctccaagtgttcaaatgcaggag
gtccctcctgacttctacattccagatttcgatgaagatgagcagaaccctgatgagcgt
attgatcagcacactcaagacaagcacatccagcgcgatgatgaatattatgaagctgac
aatgacaatgatcaaatggatgtttcatga

DBGET integrated database retrieval system