KEGG   Vigna angularis (adzuki bean): 108343391Help
Entry
108343391         CDS       T04660                                 

Definition
(RefSeq) thymidine kinase a-like
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00240  Pyrimidine metabolism
var01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    108343391
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     108343391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14 AAA_30 AAA_22 AAA_24 cobW MobB
Motif
Other DBs
NCBI-GeneID: 108343391
NCBI-ProteinID: XP_017437135
UniProt: A0A0L9VEG5
LinkDB All DBs
Position
9
AA seq 279 aa AA seqDB search
MKSLLNPKFSAFSSKASPFPLFSLPSQPTLRFSFRSSSRRIPNRLLRLNPPPFSSNNFTC
TNQNRSLQTEPSPPSSGEIHVIVGPMFAGKTTSLLRRIQLETANGRNVAVIKSSKDTRYG
LDSIVTHDGAKLPCWALANLSSFKQKFGIDAYEKLDVIGIDEAQFFDDLYEFCRQAADDD
GKTVIVSGLDGNYMRRSFGSVIDIIPLADSVTKLTATCEICKRPASFTLRKTQDKQIELI
GGVDVYMPVCRQHYVSGQVAVEAARHVLQSHKLECGSYT
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcccttctcaacccaaagttttccgctttttcttccaaagcctctccttttcct
ctcttttcactaccttctcaacccacgcttcgattttctttccgcagcagctcacgtcga
attcctaatcgtcttctccgcctcaacccacctcccttttcgtccaataatttcacttgc
accaatcaaaaccgaagcttgcaaacagagccctcgccaccttcctccggtgagatccac
gtcatagtggggcccatgttcgctggaaaaaccacctcgctcctccgtcggattcaattg
gaaactgccaacggcagaaatgtagcagtaattaaatcaagcaaggatacaagatatgga
ttagactcaattgttacacatgatggtgctaaattaccttgttgggcactggcaaactta
tcatcattcaagcagaaatttggaattgatgcttatgagaagctagatgtgattggtatc
gatgaagcgcaattcttcgatgatctttatgaattctgccgtcaagctgctgatgatgat
ggaaaaacagtaatagtttcaggattagatgggaactacatgaggaggagttttggttct
gttattgatattattccccttgctgattctgtaaccaagttaactgctacatgtgaaata
tgtaaaaggcctgcttcctttaccctgaggaagacacaggataaacagattgaattgatt
ggtggagttgatgtctacatgccagtgtgtcgacagcactatgtcagtggacaggttgcc
gtggaagctgcaagacatgtccttcaatcccacaagcttgaatgcggctcctatacataa

DBGET integrated database retrieval system