KEGG   Vigna angularis (adzuki bean): 108343714Help
Entry
108343714         CDS       T04660                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
var  Vigna angularis (adzuki bean)
Pathway
var00010  Glycolysis / Gluconeogenesis
var00051  Fructose and mannose metabolism
var00052  Galactose metabolism
var00500  Starch and sucrose metabolism
var00520  Amino sugar and nucleotide sugar metabolism
var01100  Metabolic pathways
var01110  Biosynthesis of secondary metabolites
var01200  Carbon metabolism
Module
var_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
var_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108343714
   00051 Fructose and mannose metabolism
    108343714
   00052 Galactose metabolism
    108343714
   00500 Starch and sucrose metabolism
    108343714
   00520 Amino sugar and nucleotide sugar metabolism
    108343714
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108343714
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108343714
Membrane trafficking [BR:var04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108343714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 108343714
NCBI-ProteinID: XP_017437544
UniProt: A0A0L9VGI2
LinkDB All DBs
Position
10
AA seq 498 aa AA seqDB search
MGKVAVGVAVVCAAAACAAAALVVRRRMRSSGKRGRAVAMVREFEKQCGTPIAKLRQVAD
AMDVEMHAGLASEGGSKLKMLITFVDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKG
VANLESEEVSIPPHLMTGCSHELFDFIAEKLAKFVSSEPEEFHPPPGRQRELGFTFSFPV
RQTSISSGSLIKWTKGFNIEDAVGEDVVGELTKSFEKIGLDMRVAALVNDTVGTVARARF
GNPDVVAGVILGTGTNAAYVESAHAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTPYDQ
DLDLESLNPGEQIFEKIISGMYLGDIVRRVLLKMAEEADFFGDTVPPKLKIPFIIRTPDM
SAMHHDASSDLNVVGTKLKDLLKINNTSLQMRKLVVELCDIVATRGARLSAAGIFGILKK
IGRDTVKDGEKQKSVIALDGGLFEHYTEFRSSLESTLKELLGDEAADTVGVEHSNDGSGI
GAALLAASHSQYLGVQDF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtggcggtgggagtggcagtcgtttgcgcagcggcggcgtgtgcggcggcg
gcgttggtggtgcgccgccgaatgaggagctccggaaagcggggtcgcgcggtggccatg
gtgagggagtttgagaagcagtgtgggaccccaattgcgaagctgagacaggttgctgat
gccatggacgttgagatgcacgcgggtcttgcttctgaaggtggcagcaagctcaagatg
ttgattacctttgtcgataatctcccttctggggatgagaaaggactcttttatgcgtta
gaccttggtggcacaaacttcagaacccttcgggtgcatttaggtgggaaagagaaaggt
gttgccaacctagagtctgaagaagtttccattcctcctcatttgatgactggttgctcg
catgaattgtttgactttatagcagaaaaacttgcaaagtttgttagttctgagcctgaa
gagtttcaccctccccctggtagacaaagggaactgggttttaccttctcgtttccagtg
aggcaaacatcaatttcatctggaagtctaataaagtggaccaagggtttcaatattgag
gatgcggttggagaagatgtggtgggtgaattaaccaaatccttcgaaaaaattggtctg
gatatgcgtgttgcagctctagttaatgacacagttggaacagtagctagagcaagattc
ggcaatccggatgttgttgctggagtaattcttggtactgggacaaatgcagcttatgta
gagtctgcacatgcaattccaaaatggcaaggtcttctaccaaaatcaggagagatggtt
ataaacatggagtggggtaatttccgttcctctcatcttcctctaacaccatatgatcaa
gatctagatttagagagcttaaaccctggagaacagatttttgaaaagataatttctggt
atgtatttgggtgacattgtaaggagagttttgttgaagatggctgaagaagctgacttc
tttggagatactgttcctccaaaattgaaaattcctttcataattaggacacctgacatg
tctgcaatgcatcatgatgcatcttcagatctgaatgtggttggaaccaaattgaaggat
ctattaaagatcaataacacatcccttcaaatgaggaagcttgttgttgaactctgtgat
atcgttgctactcggggagcgcgcctttctgctgctggaatctttggcatcctgaagaaa
ataggaagagacacagtaaaggatggggagaaacagaaatcagtaatagcactggatgga
ggattgtttgaacactatactgaattcagaagttccttggagagtacactaaaggagttg
ttgggagatgaggcagctgatacagttggtgttgagcattctaatgatggctctggaatt
ggagcagccctcttggcagcttctcattctcagtatttgggagtgcaagacttttga

DBGET integrated database retrieval system