KEGG   Vigna angularis (adzuki bean): 108343714Help
Entry
108343714         CDS       T04660                                 

Definition
(RefSeq) hexokinase-1-like
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
var  Vigna angularis (adzuki bean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108343714
   00051 Fructose and mannose metabolism
    108343714
   00052 Galactose metabolism
    108343714
   00500 Starch and sucrose metabolism
    108343714
   00520 Amino sugar and nucleotide sugar metabolism
    108343714
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108343714
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108343714
Membrane trafficking [BR:var04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108343714
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
10
AA seq 498 aa AA seqDB search
MGKVAVGVAVVCAAAACAAAALVVRRRMRSSGKRGRAVAMVREFEKQCGTPIAKLRQVAD
AMDVEMHAGLASEGGSKLKMLITFVDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKG
VANLESEEVSIPPHLMTGCSHELFDFIAEKLAKFVSSEPEEFHPPPGRQRELGFTFSFPV
RQTSISSGSLIKWTKGFNIEDAVGEDVVGELTKSFEKIGLDMRVAALVNDTVGTVARARF
GNPDVVAGVILGTGTNAAYVESAHAIPKWQGLLPKSGEMVINMEWGNFRSSHLPLTPYDQ
DLDLESLNPGEQIFEKIISGMYLGDIVRRVLLKMAEEADFFGDTVPPKLKIPFIIRTPDM
SAMHHDASSDLNVVGTKLKDLLKINNTSLQMRKLVVELCDIVATRGARLSAAGIFGILKK
IGRDTVKDGEKQKSVIALDGGLFEHYTEFRSSLESTLKELLGDEAADTVGVEHSNDGSGI
GAALLAASHSQYLGVQDF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagtggcggtgggagtggcagtcgtttgcgcagcggcggcgtgtgcggcggcg
gcgttggtggtgcgccgccgaatgaggagctccggaaagcggggtcgcgcggtggccatg
gtgagggagtttgagaagcagtgtgggaccccaattgcgaagctgagacaggttgctgat
gccatggacgttgagatgcacgcgggtcttgcttctgaaggtggcagcaagctcaagatg
ttgattacctttgtcgataatctcccttctggggatgagaaaggactcttttatgcgtta
gaccttggtggcacaaacttcagaacccttcgggtgcatttaggtgggaaagagaaaggt
gttgccaacctagagtctgaagaagtttccattcctcctcatttgatgactggttgctcg
catgaattgtttgactttatagcagaaaaacttgcaaagtttgttagttctgagcctgaa
gagtttcaccctccccctggtagacaaagggaactgggttttaccttctcgtttccagtg
aggcaaacatcaatttcatctggaagtctaataaagtggaccaagggtttcaatattgag
gatgcggttggagaagatgtggtgggtgaattaaccaaatccttcgaaaaaattggtctg
gatatgcgtgttgcagctctagttaatgacacagttggaacagtagctagagcaagattc
ggcaatccggatgttgttgctggagtaattcttggtactgggacaaatgcagcttatgta
gagtctgcacatgcaattccaaaatggcaaggtcttctaccaaaatcaggagagatggtt
ataaacatggagtggggtaatttccgttcctctcatcttcctctaacaccatatgatcaa
gatctagatttagagagcttaaaccctggagaacagatttttgaaaagataatttctggt
atgtatttgggtgacattgtaaggagagttttgttgaagatggctgaagaagctgacttc
tttggagatactgttcctccaaaattgaaaattcctttcataattaggacacctgacatg
tctgcaatgcatcatgatgcatcttcagatctgaatgtggttggaaccaaattgaaggat
ctattaaagatcaataacacatcccttcaaatgaggaagcttgttgttgaactctgtgat
atcgttgctactcggggagcgcgcctttctgctgctggaatctttggcatcctgaagaaa
ataggaagagacacagtaaaggatggggagaaacagaaatcagtaatagcactggatgga
ggattgtttgaacactatactgaattcagaagttccttggagagtacactaaaggagttg
ttgggagatgaggcagctgatacagttggtgttgagcattctaatgatggctctggaatt
ggagcagccctcttggcagcttctcattctcagtatttgggagtgcaagacttttga

DBGET integrated database retrieval system