KEGG   Vigna angularis (adzuki bean): 108347521Help
Entry
108347521         CDS       T04660                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
var  Vigna angularis (adzuki bean)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:var00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    108347521
   00051 Fructose and mannose metabolism
    108347521
   00052 Galactose metabolism
    108347521
   00500 Starch and sucrose metabolism
    108347521
   00520 Amino sugar and nucleotide sugar metabolism
    108347521
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    108347521
Enzymes [BR:var01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     108347521
Membrane trafficking [BR:var04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    108347521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
11
AA seq 497 aa AA seqDB search
MGKVAVGAAVVCAAAVCAAAALVVRHRMISSRKWSRAMAILKDFEEKSGTPLAKLRQVAD
AMDVEMHAGLASEGGSKLNMLISFVDNLPTGDEKGLYYALDLGGTNFRVLRVHLGGKDKG
VLGQEFAEVSIPPHLMTGTSEALFDFIAAALAKFVASEPEGFHPPPGRQRELGFTFSFPV
RQTSISSGTLIKWTKGFNIEDTVGEDVVGELTKSMEKIGLDMRIAALVNDTIGTLAGGRF
YNQDVIAAVILGTGTNAAYVERAHAIPKWHGLIPKSGDMVINMEWGNFRSNLSLTEYDLA
LDAESLNPGEQIFEKLISGMYLGEIIRRVLLKMAEEADFFGDTVPPKLKVPFILRTPDMA
AMHHDTTPDLKVVGNKLKDTLEISNTSLKMRKIVVELCDIVATRGARLAAAGILGILKKL
GRDTVKVGEKQKSVIALDGGLYEHYTKFRECLESTLKELLGEEAAETIVIEHANDGSGIG
AALLAASHSQYLGVEES
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggtcgcggtgggagctgctgttgtctgtgccgcggccgtttgtgccgcggcg
gcgctggtggtgcgccaccgcatgattagttcccgcaagtggagtcgagccatggccata
ctgaaagactttgaggaaaagagtgggaccccacttgcgaagctcagacaagtggctgat
gccatggatgtggagatgcacgcagggctcgcatctgaaggtggtagcaagcttaacatg
ttgatcagtttcgtcgacaatctccctactggggatgagaaaggactctattatgcactg
gatcttggtggcacaaacttccgtgtccttcgtgtacatttgggtgggaaagacaaaggt
gttcttggccaagagtttgcagaagtttcaattcctccacatttgatgactggtacttcg
gaggcattatttgattttatagcagcagctcttgccaagtttgttgcttcagaaccagaa
ggttttcatcctccacccggcagacaaagagaactgggttttacattctcattcccagtg
aggcaaacatcaatttcatctgggactctaattaagtggactaaaggttttaatattgaa
gatacggttggtgaagatgtagtgggagagctaaccaagtccatggaaaaaattgggctg
gatatgcgaattgctgctctagttaatgataccattggaacattagccggaggcagattc
tacaatcaggatgtaattgctgctgtgattcttggtactgggacaaatgcagcatatgta
gaacgtgcacatgctattccaaaatggcacggccttataccaaaatctggagatatggtt
ataaacatggagtggggtaatttccgatcaaatctttctctaacagaatatgatctggct
cttgatgctgagagtttaaaccctggagaacagatttttgagaaattgatttcgggcatg
tatttgggggagattattaggagagttttgttgaagatggctgaagaagctgactttttt
ggagatactgttccacccaaattgaaagttcctttcatacttaggacacctgacatggca
gccatgcaccacgacactactcctgatctgaaagtggttggaaacaaattaaaggataca
ttagagatctcgaacacttccctaaaaatgaggaagattgttgtggaactatgtgacatt
gttgctactcgcggggcccgccttgctgctgctggtattttgggcatcctcaagaaacta
ggaagagacacagttaaggttggggagaagcaaaagtcagtgatagcattggatggagga
ttgtatgaacactacactaaattcagagaatgcctggagagtacactgaaggaattgctg
ggagaggaggctgctgagaccattgtcattgagcacgctaatgatggctccggcattggt
gcagcccttctagcagcttctcactcccaatatttgggagtggaggagtcttaa

DBGET integrated database retrieval system